hmmsearch - search a sequence database with a profile HMM
HMMER 2.2g (August 2001)
Copyright (C) 1992-2001 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                   NBS_SubDomB.hmm [NBS_SubDomB]
Sequence database:          /data1/GenBank/nr
per-sequence score cutoff:  [none]
per-domain score cutoff:    [none]
per-sequence Eval cutoff:   <= 10        
per-domain Eval cutoff:     [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM:   NBS_SubDomB
Accession:   [none]
Description: [none]
  [HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence                              Description       Score    E-value  N 
--------                              -----------       -----    ------- ---
gi|7488170|pir||D71437                probable resist  1522.5          0   2
gi|6227009|gb|AAF06045.1|AC009513_1   (AC009513) Stro   923.1   9.3e-273   1
gi|9758812|dbj|BAB09346.1|            (AB005248) dise   920.6   5.4e-272   1
gi|8953387|emb|CAB96660.1|            (AL360314) RPP1   903.8   6.2e-267   1
gi|7488217|pir||F71405                probable TMV re   902.7   1.3e-266   1
gi|10178009|dbj|BAB11461.1|           (AB005233) dise   900.1   8.3e-266   1
gi|10178243|dbj|BAB11675.1|           (AB006699) dise   893.8   6.3e-264   1
gi|8843884|dbj|BAA97410.1|            (AB025635) dise   892.6   1.5e-263   1
gi|6598711|gb|AAD25848.2|AC007197_1   (AC007197) puta   891.0   4.4e-263   1
gi|9759538|dbj|BAB11004.1|            (AB024029) dise   889.5   1.2e-262   1
gi|8843883|dbj|BAA97409.1|            (AB025635) dise   886.3   1.2e-261   1
gi|12324940|gb|AAG52419.1|AC011622_7  (AC011622) puta   884.8   3.2e-261   1
gi|9757889|dbj|BAB08396.1|            (AB015473) dise   881.8   2.6e-260   1
gi|7486351|pir||T01916                hypothetical pr   881.8   2.6e-260   1
gi|7487334|pir||T08196                hypothetical pr   881.8   2.6e-260   1
gi|3757516|gb|AAC64218.1|             (AC005167) puta   881.5   3.2e-260   1
gi|9758866|dbj|BAB09448.1|            (AB011481) dise   881.0   4.7e-260   1
gi|10177970|dbj|BAB11353.1|           (AB011477) dise   880.3   7.5e-260   1
gi|6721163|gb|AAF26791.1|AC016829_15  (AC016829) puta   877.3     6e-259   1
gi|12325006|gb|AAG52448.1|AC010852_5  (AC010852) puta   877.0   7.4e-259   1
gi|6692110|gb|AAF24575.1|AC007764_17  (AC007764) F22C   875.3   2.3e-258   1
gi|10177582|dbj|BAB10813.1|           (AB019223) dise   871.2     4e-257   1
gi|7485310|pir||T14515                hypothetical pr   864.7   3.8e-255   1
gi|10178008|dbj|BAB11460.1|           (AB005233) dise   864.6     4e-255   1
gi|10177708|dbj|BAB11082.1|           (AB010698) dise   864.5   4.3e-255   1
gi|10177707|dbj|BAB11081.1|           (AB010698) dise   862.2   2.1e-254   1
gi|9279731|dbj|BAB01321.1|            (AB025639) dise   860.4   7.1e-254   1
gi|9954758|gb|AAG09109.1|AC009323_20  (AC009323) Puta   860.2   8.5e-254   1
gi|10177584|dbj|BAB10815.1|           (AB019223) dise   860.0   9.7e-254   1
gi|9758704|dbj|BAB09158.1|            (AB017065) dise   854.2   5.3e-252   1
gi|12324938|gb|AAG52417.1|AC011622_5  (AC011622) puta   853.3     1e-251   1
gi|12322541|gb|AAG51270.1|AC027135_11 (AC027135) dise   849.9     1e-250   1
gi|12597847|gb|AAG60157.1|AC074360_22 (AC074360) down   849.9     1e-250   1
gi|3860163|gb|AAC72977.1|             (AF098962) dise   848.5   2.9e-250   1
gi|9758205|dbj|BAB08679.1|            (AB018109) dise   845.2   2.7e-249   1
gi|10177588|dbj|BAB10819.1|           (AB019223) dise   842.3     2e-248   1
gi|9758062|dbj|BAB08641.1|            (AB009048) dise   841.9   2.7e-248   1
gi|10177589|dbj|BAB10820.1|           (AB019223) dise   841.6   3.3e-248   1
gi|11357256|pir||T48928               disease resista   841.5   3.6e-248   1
gi|10176947|dbj|BAB10096.1|           (AB023028) dise   841.3   4.1e-248   1
gi|12325008|gb|AAG52450.1|AC010852_7  (AC010852) puta   840.3   8.3e-248   1
gi|3860165|gb|AAC72978.1|             (AF098963) dise   838.1   3.6e-247   1
gi|11357250|pir||T47442               disease resista   836.1   1.5e-246   1
gi|10177586|dbj|BAB10817.1|           (AB019223) dise   834.6   4.2e-246   1
gi|3860167|gb|AAC72979.1|             (AF098964) dise   829.7   1.3e-244   1
gi|11357251|pir||T47438               disease resista   828.8   2.3e-244   1
gi|12324936|gb|AAG52415.1|AC011622_3  (AC011622) puta   822.6   1.8e-242   1
gi|5302807|emb|CAB46048.1|            (Z97342) diseas   821.1   4.8e-242   1
gi|5302803|emb|CAB46044.1|            (Z97342) diseas   813.4     1e-239   1
gi|7485210|pir||H71436                hypothetical pr   813.4     1e-239   1
gi|11357260|pir||T47430               disease resiste   812.9   1.5e-239   1
gi|12323031|gb|AAG51508.1|AC058785_11 (AC058785) dise   808.3   3.5e-238   1
gi|6449046|gb|AAF08790.1|             (AF180942) down   801.8   3.3e-236   1
gi|12597786|gb|AAG60098.1|AC073178_9  (AC073178) dise   801.5   3.9e-236   1
gi|14532598|gb|AAK64027.1|            (AY039923) puta   801.5   3.9e-236   1
gi|7488168|pir||C71436                probable resist   800.1     1e-235   1
gi|5302806|emb|CAB46047.1|            (Z97342) diseas   798.3   3.5e-235   1
gi|7488173|pir||G71437                probable resist   796.6   1.1e-234   1
gi|5302805|emb|CAB46046.1|            (Z97342) diseas   794.3   5.7e-234   1
gi|9954759|gb|AAG09110.1|AC009323_21  (AC009323) Puta   791.4   4.4e-233   1
gi|12323030|gb|AAG51507.1|AC058785_10 (AC058785) dise   791.4   4.4e-233   1
gi|10177430|dbj|BAB10522.1|           (AB023040) dise   768.4   3.5e-226   1
gi|5302808|emb|CAB46049.1|            (Z97342) diseas   752.2   2.7e-221   1
gi|7488166|pir||A71437                probable resist   740.9   6.9e-218   1
gi|7488167|pir||B71437                probable resist   716.7   1.3e-210   1
gi|7485134|pir||E71436                hypothetical pr   702.2     3e-206   1
gi|7268442|emb|CAB80962.1|            (AL161545) dise   697.8   6.3e-205   1
gi|8843806|dbj|BAA97354.1|            (AB022222) dise   665.8   2.8e-195   1
gi|9759045|dbj|BAB09567.1|            (AB006706) dise   513.1   2.5e-149   1
gi|10944739|emb|CAC14089.1|           (AJ299417) hypo   428.5   7.5e-124   1
gi|7488174|pir||A71438                probable resist   413.5   2.4e-119   1
gi|6721164|gb|AAF26792.1|AC016829_16  (AC016829) puta   396.0   4.5e-114   1
gi|5302809|emb|CAB46050.1|            (Z97342) diseas   382.0   7.7e-110   1
gi|9758876|dbj|BAB09430.1|            (AB012242) dise   372.6     5e-107   1
gi|7484921|pir||T06143                disease resiste   352.9   4.2e-101   2
gi|8778469|gb|AAF79477.1|AC022492_21  (AC022492) F1L3   351.1   1.5e-100   1
gi|5903073|gb|AAD55631.1|AC008017_4   (AC008017) Simi   345.8    5.8e-99   1
gi|9758746|dbj|BAB09118.1|            (AB022222) gene   345.5    7.4e-99   1
gi|12322617|gb|AAG51311.1|AC026480_18 (AC026480) dise   311.2    1.6e-88   1
gi|5903075|gb|AAD55633.1|AC008017_6   (AC008017) Simi   302.4      7e-86   1
gi|3947735|emb|CAA08798.1|            (AJ009720) NL27   290.0    3.6e-82   1
gi|12056928|gb|AAG48132.1|AF322632_1  (AF322632) puta   288.9    7.8e-82   1
gi|1086263|pir||A54810                TMV resistance    265.9    6.8e-75   1
gi|9965103|gb|AAG09951.1|             (AF175388) resi   265.4    9.4e-75   1
gi|7484909|pir||T06608                disease resista   264.9    1.4e-74   1
gi|7488375|pir||T04583                TMV resistance    264.1    2.3e-74   2
gi|7267585|emb|CAB78066.1|            (AL161514) puta   247.9    1.8e-69   1
gi|10178211|dbj|BAB11635.1|           (AB016877) TMV    245.2    1.1e-68   1
gi|9965107|gb|AAG09953.1|AF175398_1   (AF175398) resi   231.4    1.6e-64   1
gi|12003378|gb|AAG43546.1|AF211528_1  (AF211528) Avr9   211.5    1.5e-58   1
gi|9965105|gb|AAG09952.1|AF175389_1   (AF175389) resi   209.8      5e-58   1
gi|12056930|gb|AAG48133.1|AF322633_1  (AF322633) puta   208.3    1.5e-57   1
gi|7267578|emb|CAB78059.1|            (AL161514) puta   201.3    1.8e-55   1
gi|7484912|pir||T06144                disease resista   199.2    8.1e-55   1
gi|3947733|emb|CAA08797.1|            (AJ009719) NL25   174.4    2.3e-47   1
gi|7488903|pir||T18548                flax rust resis   166.2    6.9e-45   1
gi|10177497|dbj|BAB10888.1|           (AB010693) dise   165.1    1.4e-44   1
gi|10121909|gb|AAG13419.1|AC000348_16 (AC000348) T7N9   165.1    1.4e-44   1
gi|12321343|gb|AAG50739.1|AC079733_7  (AC079733) dise   162.6    8.3e-44   1
gi|4588054|gb|AAD25968.1|AF093641_2   (AF093641) flax   159.9    5.4e-43   1
gi|7488902|pir||T18547                flax rust resis   159.4    7.6e-43   1
gi|7488901|pir||T18546                flax rust resis   159.4    7.6e-43   1
gi|4588064|gb|AAD25973.1|AF093646_1   (AF093646) flax   159.4    7.6e-43   1
gi|4588048|gb|AAD25965.1|AF093638_1   (AF093638) flax   157.9    2.2e-42   1
gi|4588066|gb|AAD25974.1|AF093647_1   (AF093647) flax   156.4    5.9e-42   1
gi|4588068|gb|AAD25975.1|AF093648_2   (AF093648) flax   156.3    6.5e-42   1
gi|4588056|gb|AAD25969.1|AF093642_1   (AF093642) flax   153.4    4.8e-41   1
gi|4588070|gb|AAD25976.1|AF093649_1   (AF093649) flax   152.9      7e-41   1
gi|10176997|dbj|BAB10247.1|           (AB020744) dise   152.2    1.1e-40   1
gi|4588060|gb|AAD25971.1|AF093644_1   (AF093644) flax   151.2    2.2e-40   1
gi|7484913|pir||T06145                disease resista   150.9    2.7e-40   1
gi|4588052|gb|AAD25967.1|AF093640_1   (AF093640) flax   149.2      9e-40   1
gi|4588050|gb|AAD25966.1|AF093639_1   (AF093639) flax   149.0      1e-39   1
gi|10121908|gb|AAG13418.1|AC000348_15 (AC000348) T7N9   144.5    2.4e-38   1
gi|11357257|pir||T45787               disease resista   139.1    9.5e-37   1
gi|4588062|gb|AAD25972.1|AF093645_1   (AF093645) flax   135.7      1e-35   1
gi|11358639|pir||T45788               probable diseas   132.5    9.2e-35   1
gi|7488376|pir||T04584                TMV resistance    127.8    2.4e-33   1
gi|10177890|dbj|BAB11222.1|           (AB011480) dise   121.3    2.3e-31   1
gi|13509217|emb|CAC35328.1|           (AJ310153) N1-B   119.2    9.3e-31   1
gi|7484910|pir||T06609                disease resista   119.2    9.5e-31   1
gi|13509215|emb|CAC35327.1|           (AJ310152) N1-A   118.6    1.4e-30   1
gi|13509211|emb|CAC35325.1|           (AJ310150) Ngc-   118.5    1.5e-30   1
gi|13509225|emb|CAC35332.1|           (AJ310157) N2-B   115.9    9.2e-30   1
gi|11357255|pir||T51141               disease resista   115.6    1.1e-29   1
gi|5823587|emb|CAB53785.1|            (AJ249264) dise   115.6    1.1e-29   1
gi|11357254|pir||T51140               disease resista   114.0    3.6e-29   1
gi|2660663|gb|AAC79134.1|             (AC002342) puta   106.7    5.5e-27   1
gi|13517483|gb|AAK28812.1|AF310968_1  (AF310968) resi   105.3    1.5e-26   1
gi|9759606|dbj|BAB11394.1|            (AB012240) dise   104.0    3.6e-26   1
gi|11761682|gb|AAG40141.1|AF209498_1  (AF209498) dise   103.7    4.5e-26   1
gi|13509209|emb|CAC35323.1|           (AJ310150) Ngc-   103.5      5e-26   1
gi|13509223|emb|CAC35331.1|           (AJ310156) N2-A   103.5      5e-26   1
gi|13517477|gb|AAK28810.1|AF310964_1  (AF310964) resi   102.5    9.9e-26   1
gi|13517480|gb|AAK28811.1|AF310966_1  (AF310966) resi   102.5      1e-25   1
gi|15028063|gb|AAK76562.1|            (AY045888) puta   100.4    4.5e-25   1
gi|13517469|gb|AAK28806.1|AF310960_2  (AF310960) P2 r    97.1    4.4e-24   1
gi|10177889|dbj|BAB11221.1|           (AB011480) dise    93.3      6e-23   1
gi|9758979|dbj|BAB09489.1|            (AB019224) dise    92.4    1.1e-22   1
gi|13509213|emb|CAC35326.1|           (AJ310151) Ngc-    90.0    6.1e-22   1
gi|6598361|gb|AAF18599.1|AC002354_8   (AC002354) puta    89.3    9.3e-22   1
gi|13509207|emb|CAC35321.1|           (AJ310150) Ngc-    87.3    3.8e-21   1
gi|13509234|emb|CAC35337.1|           (AJ310162) Nbi-    87.2      4e-21   1
gi|13509238|emb|CAC35339.1|           (AJ310164) Nho-    86.6    6.3e-21   1
gi|13509236|emb|CAC35338.1|           (AJ310163) Nbi-    85.1    1.7e-20   1
gi|13517474|gb|AAK28809.1|AF310962_1  (AF310962) resi    84.9    2.1e-20   1
gi|13509219|emb|CAC35329.1|           (AJ310154) N1-C    83.8    4.3e-20   1
gi|13509221|emb|CAC35330.1|           (AJ310155) N1-D    83.6      5e-20   1
gi|13517464|gb|AAK28803.1|AF310958_1  (AF310958) resi    81.4    2.3e-19   1
gi|13517466|gb|AAK28804.1|AF310959_1  (AF310959) resi    81.4    2.3e-19   1
gi|6598362|gb|AAF18600.1|AC002354_9   (AC002354) puta    79.9    6.7e-19   1
gi|13509227|emb|CAC35333.1|           (AJ310158) N2-C    79.2    1.1e-18   1
gi|9759605|dbj|BAB11393.1|            (AB012240) dise    78.2    2.1e-18   1
gi|13517468|gb|AAK28805.1|AF310960_1  (AF310960) resi    76.9    5.3e-18   1
gi|13517472|gb|AAK28808.1|AF310961_1  (AF310961) resi    76.9    5.3e-18   1
gi|13509229|emb|CAC35334.1|           (AJ310159) N2-D    76.8    5.7e-18   1
gi|8778463|gb|AAF79471.1|AC022492_15  (AC022492) F1L3    70.9    2.4e-16   1
gi|9759608|dbj|BAB11396.1|            (AB012240) dise    50.4    2.7e-15   1
gi|8843808|dbj|BAA97356.1|            (AB022222) dise    49.6      3e-15   1
gi|5903074|gb|AAD55632.1|AC008017_5   (AC008017) Simi    25.3    5.5e-14   1
gi|7267584|emb|CAB78065.1|            (AL161514) puta    23.9    6.4e-14   1
gi|9758877|dbj|BAB09431.1|            (AB012242) cont    12.0    2.7e-13   1
gi|9858478|gb|AAG01052.1|AF175395_1   (AF175395) resi     9.9    3.4e-13   1
gi|9858476|gb|AAG01051.1|AF175394_1   (AF175394) resi    -3.4    1.7e-12   1
gi|7484914|pir||T06146                disease resista   -19.8    1.2e-11   1
gi|5903076|gb|AAD55634.1|AC008017_7   (AC008017) Simi   -25.8    2.4e-11   1
gi|4100321|gb|AAD00827.1|             (U96642) A sunf   -28.7    3.4e-11   1
gi|3176745|gb|AAC50026.1|             (U97218) diseas   -53.5    6.5e-10   1
gi|13310478|gb|AAK18307.1|AF338975_1  (AF338975) dise   -54.3    7.1e-10   1
gi|13310476|gb|AAK18306.1|AF338974_1  (AF338974) dise   -55.5    8.1e-10   1
gi|13310457|gb|AAK18297.1|AF338964_1  (AF338964) dise   -62.4    1.9e-09   1
gi|11761674|gb|AAG40138.1|AF209493_1  (AF209493) dise   -68.2    3.7e-09   1
gi|11761672|gb|AAG40137.1|AF209492_1  (AF209492) dise   -69.4    4.3e-09   1
gi|7484488|pir||T08068                resistance prot   -72.7    6.3e-09   1
gi|6648975|gb|AAF21316.1|             (AF121436) dise  -102.7    2.2e-07   1
gi|6648973|gb|AAF21315.1|             (AF121435) dise  -103.9    2.6e-07   1
gi|6648977|gb|AAF21317.1|AF121437_1   (AF121437) dise  -108.1    4.3e-07   1
gi|5903078|gb|AAD55636.1|AC008017_9   (AC008017) Simi  -110.1    5.4e-07   1
gi|7488668|pir||T08833                disease resista  -114.3    8.9e-07   1
gi|5903084|gb|AAD55642.1|AC008017_15  (AC008017) Simi  -114.3    8.9e-07   1
gi|2852684|gb|AAC02202.1|             (AF017751) resi  -116.4    1.1e-06   1
gi|7107244|gb|AAF36336.1|AF186628_1   (AF186628) unkn  -116.7    1.2e-06   1
gi|7107236|gb|AAF36332.1|AF186624_1   (AF186624) unkn  -118.0    1.4e-06   1
gi|13937090|gb|AAK50044.1|AF363799_1  (AF363799) puta  -118.8    1.5e-06   1
gi|13897754|gb|AAK48438.1|AF255462_1  (AF255462) resi  -119.8    1.7e-06   1
gi|13194664|gb|AAK15497.1|AF325686_1  (AF325686) resi  -122.7    2.4e-06   1
gi|4519936|dbj|BAA75812.1|            (AB019186) RPR1  -128.7    4.9e-06   1
gi|4519938|dbj|BAA75813.1|            (AB019240) RPR1  -128.8      5e-06   1
gi|13897758|gb|AAK48440.1|AF255464_1  (AF255464) resi  -129.1    5.2e-06   1
gi|7107238|gb|AAF36333.1|AF186625_1   (AF186625) unkn  -129.1    5.2e-06   1
gi|10176995|dbj|BAB10245.1|           (AB020744) cont  -129.5    5.5e-06   1
gi|7649322|emb|CAB88868.1|            (AJ251869) puta  -130.2      6e-06   1
gi|5903079|gb|AAD55637.1|AC008017_10  (AC008017) Simi  -130.8    6.4e-06   1
gi|7107254|gb|AAF36341.1|AF186633_1   (AF186633) unkn  -132.8      8e-06   1
gi|5903080|gb|AAD55638.1|AC008017_11  (AC008017) Simi  -133.3    8.6e-06   1
gi|7489065|pir||T06403                resistance comp  -133.3    8.6e-06   1
gi|14589374|gb|AAK70629.1|AC091238_7  (AC091238) Puta  -134.7      1e-05   1
gi|13194662|gb|AAK15496.1|AF325685_1  (AF325685) resi  -134.8      1e-05   1
gi|7488662|pir||T08819                disease resista  -136.8    1.3e-05   1
gi|13897756|gb|AAK48439.1|AF255463_1  (AF255463) resi  -138.7    1.6e-05   1
gi|7107240|gb|AAF36334.1|AF186626_1   (AF186626) unkn  -141.3    2.2e-05   1
gi|7486805|pir||T05746                hypothetical pr  -141.5    2.3e-05   1
gi|7107242|gb|AAF36335.1|AF186627_1   (AF186627) unkn  -142.2    2.5e-05   1
gi|7107246|gb|AAF36337.1|AF186629_1   (AF186629) unkn  -143.0    2.7e-05   1
gi|7443914|pir||T06049                hypothetical pr  -145.5    3.6e-05   1
gi|13897764|gb|AAK48443.1|AF255467_1  (AF255467) resi  -145.5    3.7e-05   1
gi|13897762|gb|AAK48442.1|AF255466_1  (AF255466) resi  -146.3      4e-05   1
gi|8927667|gb|AAF82158.1|AC034256_22  (AC034256) Cont  -146.8    4.3e-05   1
gi|7489239|pir||T07769                disease resista  -147.5    4.6e-05   1
gi|5903083|gb|AAD55641.1|AC008017_14  (AC008017) Simi  -149.5    5.9e-05   1
gi|13937096|gb|AAK50047.1|AF363802_1  (AF363802) puta  -150.2    6.4e-05   1
gi|4689223|gb|AAD27815.1|AF118127_1   (AF118127) dise  -150.2    6.4e-05   1
gi|14028983|gb|AAK52524.1|AC079128_7  (AC079128) Puta  -150.7    6.8e-05   1
gi|13897752|gb|AAK48437.1|AF255461_1  (AF255461) resi  -152.8    8.7e-05   1
gi|13897760|gb|AAK48441.1|AF255465_1  (AF255465) resi  -152.8    8.7e-05   1
gi|6456755|gb|AAF09256.1|AF202179_1   (AF202179) dise  -153.2    9.2e-05   1
gi|7489066|pir||T06404                resistance comp  -153.3    9.2e-05   1
gi|4164087|gb|AAD08712.1|             (AF116848) resi  -153.9      1e-04   1
gi|11357259|pir||T48468               disease resista  -154.8    0.00011   1
gi|7649326|emb|CAB88870.1|            (AJ251871) puta  -155.0    0.00011   1
gi|5911745|emb|CAB55838.1|            (AJ249449) NBS-  -155.4    0.00012   1
gi|7489237|pir||T07767                disease resista  -155.5    0.00012   1
gi|3309619|gb|AAC26125.1|             (AF074916) NBS/  -156.4    0.00013   1
gi|11611778|gb|AAG39059.1|            (AF281282) NBS-  -156.7    0.00014   1
gi|625973|pir||A54809                 disease resista  -157.5    0.00015   1
gi|12231681|gb|AAG49214.1|            (AF272765) resi  -157.8    0.00016   1
gi|7488663|pir||T08820                disease resista  -158.4    0.00017   1
gi|10176752|dbj|BAB09983.1|           (AB010692) NBS/  -158.4    0.00017   1
gi|8809611|dbj|BAA97162.1|            (AB018117) dise  -158.7    0.00018   1
gi|7488669|pir||T08835                disease resista  -159.4    0.00019   1
gi|13377497|gb|AAK20736.1|            (AF325196) LRR1  -159.6    0.00019   1
gi|5669782|gb|AAD46471.1|AF108010_1   (AF108010) Hv1L  -159.7     0.0002   1
gi|11278007|pir||T45590               hypothetical pr  -160.2    0.00021   1
gi|5918254|emb|CAB56299.1|            (AJ249448) NBS-  -160.8    0.00023   1
gi|7649324|emb|CAB88869.1|            (AJ251870) puta  -160.9    0.00023   1
gi|13897750|gb|AAK48436.1|AF255460_1  (AF255460) resi  -161.0    0.00023   1
gi|11278005|pir||T51185               resistance prot  -161.1    0.00023   1
gi|13872897|dbj|BAB44004.1|           (AP002540) puta  -161.5    0.00025   1
gi|6635380|gb|AAF19803.1|             (AF180355) RPS2  -162.3    0.00027   1
gi|7107266|gb|AAF36347.1|AF186639_1   (AF186639) unkn  -162.5    0.00028   1
gi|13702829|gb|AAK38505.1|AC087181_21 (AC087181) puta  -163.8    0.00032   1
gi|7443913|pir||T12979                hypothetical pr  -164.3    0.00034   1
gi|13937094|gb|AAK50046.1|AF363801_1  (AF363801) puta  -164.8    0.00036   1
gi|15088547|gb|AAK84083.1|AF326781_9  (AF326781) puta  -164.9    0.00037   1
gi|7488665|pir||T08824                disease resista  -165.4    0.00039   1
gi|13937100|gb|AAK50049.1|AF363804_1  (AF363804) puta  -165.9    0.00041   1
gi|7485661|pir||T05981                hypothetical pr  -166.0    0.00042   1
gi|13661831|gb|AAK38117.1|AF368301_1  (AF368301) dise  -166.4    0.00044   1
gi|7107260|gb|AAF36344.1|AF186636_1   (AF186636) unkn  -166.8    0.00046   1
gi|10177941|dbj|BAB11300.1|           (AB026651) dise  -167.7    0.00051   1
gi|7489353|pir||T30559                resistance prot  -168.6    0.00057   1
gi|6573285|dbj|BAA88265.1|            (AB008018) simi  -169.1     0.0006   1
gi|12321042|gb|AAG50638.1|AC082643_2  (AC082643) dise  -169.1     0.0006   1
gi|13937098|gb|AAK50048.1|AF363803_1  (AF363803) puta  -169.3    0.00062   1
gi|11278006|pir||T51186               resistance prot  -169.7    0.00065   1
gi|13377505|gb|AAK20742.1|            (AF325198) LRR1  -169.9    0.00067   1
gi|10998939|gb|AAG26078.1|AC069299_4  (AC069299) dise  -170.0    0.00068   1
gi|5524754|emb|CAB50786.1|            (AJ011801) Rx p  -170.1    0.00068   1
gi|8778651|gb|AAF79659.1|AC025416_33  (AC025416) F5O1  -171.1    0.00077   1
gi|7488666|pir||T08831                disease resista  -171.3    0.00079   1
gi|7488661|pir||T08834                disease resista  -172.0    0.00086   1
gi|8809608|dbj|BAA97159.1|            (AB018117) NBS/  -173.0    0.00096   1
gi|7488667|pir||T08832                disease resista  -173.7     0.0011   1
gi|9758302|dbj|BAB08845.1|            (AB009051) NBS/  -173.9     0.0011   1
gi|8118179|gb|AAF72926.1|             (AF230848) resi  -174.3     0.0011   1
gi|7489235|pir||T07772                disease resista  -174.5     0.0012   1
gi|13872900|dbj|BAB44007.1|           (AP002540) puta  -174.9     0.0012   1
gi|3309620|gb|AAC26126.1|             (AF074916) resi  -174.9     0.0012   1
gi|11990497|gb|AAG42167.1|AF149112_1  (AF149112) stri  -175.2     0.0012   1
gi|2129652|pir||S71195                myosin heavy ch  -175.8     0.0013   1
gi|7484911|pir||T08416                disease resista  -175.8     0.0013   1
gi|5817343|gb|AAD52715.1|AF123699_1   (AF123699) puta  -176.8     0.0015   1
gi|13194660|gb|AAK15495.1|AF325684_1  (AF325684) resi  -176.8     0.0015   1
gi|13872974|dbj|BAB44079.1|           (AP003073) puta  -177.3     0.0016   1
gi|8515762|gb|AAF76163.1|AF266747_1   (AF266747) RGC1  -177.9     0.0017   1
gi|13937086|gb|AAK50042.1|AF363797_1  (AF363797) puta  -178.2     0.0018   1
gi|7415941|dbj|BAA93618.1|            (AB013451) NBS-  -178.7     0.0019   1
gi|8925783|gb|AAF81616.1|             (AF143553) resi  -179.0      0.002   1
gi|5734781|gb|AAD50046.1|AC007980_11  (AC007980) Very  -179.5     0.0021   1
gi|7488664|pir||T08821                disease resista  -179.7     0.0021   1
gi|11990500|gb|AAG42168.1|            (AF149114) stri  -179.8     0.0022   1
gi|12330442|gb|AAG52758.1|AF263329_1  (AF263329) dise  -179.8     0.0022   1
gi|4521190|dbj|BAA76281.1|            (AB013448) Pib   -180.1     0.0022   1
gi|6172381|dbj|BAA85975.1|            (AB026839) Pi-b  -180.1     0.0022   1
gi|7489348|pir||T08421                resistance prot  -180.1     0.0023   1
gi|14348622|gb|AAK61318.1|AF306502_1  (AF306502) NBS-  -180.3     0.0023   1
gi|8118168|gb|AAF72922.1|             (AF230842) resi  -180.5     0.0024   1
gi|9758146|dbj|BAB08703.1|            (AB015477) dise  -180.8     0.0024   1
gi|11612210|gb|AAG37354.1|            (AY009938) Mla1  -181.3     0.0026   1
gi|14348619|gb|AAK61317.1|AF306501_1  (AF306501) NBS-  -181.6     0.0027   1
gi|5669778|gb|AAD46469.1|AF108008_1   (AF108008) HV1L  -181.9     0.0028   1
gi|8118158|gb|AAF72917.1|             (AF230837) resi  -181.9     0.0028   1
gi|13937092|gb|AAK50045.1|AF363800_1  (AF363800) puta  -182.0     0.0028   1
gi|2852690|gb|AAC02205.1|             (AF017754) resi  -182.3     0.0029   1
gi|13310471|gb|AAK18304.1|AF338971_1  (AF338971) dise  -183.0     0.0032   1
gi|9965109|gb|AAG09954.1|AF175399_1   (AF175399) resi  -183.4     0.0033   1
gi|12957124|emb|CAC29241.1|           (AJ302292) MLA6  -183.6     0.0034   1
gi|7443912|pir||T12977                hypothetical pr  -183.7     0.0034   1
gi|8118164|gb|AAF72920.1|             (AF230840) resi  -184.6     0.0038   1
gi|10177942|dbj|BAB11301.1|           (AB026651) dise  -185.3     0.0042   1
gi|7489501|pir||T02213                NBS-LRR type re  -185.6     0.0043   1
gi|8118171|gb|AAF72923.1|             (AF230843) resi  -186.8      0.005   1
gi|9858473|gb|AAG01049.1|             (AF175393) resi  -188.2     0.0059   1
gi|11994216|dbj|BAB01338.1|           (AB028617) dise  -188.2     0.0059   1
gi|8118162|gb|AAF72919.1|             (AF230839) resi  -188.6     0.0062   1
gi|8517418|emb|CAB94290.1|            (AJ250322) hypo  -188.8     0.0063   1
gi|14348616|gb|AAK61316.1|AF306500_1  (AF306500) NBS-  -188.9     0.0064   1
gi|8118183|gb|AAF72927.1|             (AF230850) resi  -189.1     0.0065   1
gi|3426261|gb|AAC32253.1|             (U81378) diseas  -189.4     0.0068   1
gi|7489037|pir||T06267                nematodes resis  -189.4     0.0068   1
gi|2443883|gb|AAB71476.1|             (AC002294) Simi  -190.8      0.008   1
gi|7489071|pir||T07872                root-knot nemat  -191.3     0.0085   1
gi|4050014|gb|AAC97933.1|             (AF091048) dise  -191.3     0.0085   1
gi|7489072|pir||T06269                root-knot nemat  -191.8      0.009   1
gi|5454205|gb|AAD43620.1|AC005698_19  (AC005698) T3P1  -191.8      0.009   1
gi|3056600|gb|AAC13911.1|AAC13911     (AC004255) T1F9  -192.3     0.0095   1
gi|9711875|dbj|BAB07969.1|            (AP002524) Lyco  -192.8       0.01   1
gi|7443911|pir||T01899                disease resista  -192.9       0.01   1
gi|7489236|pir||T07774                disease resista  -193.3      0.011   1
gi|7489352|pir||T30558                resistance prot  -193.3      0.011   1
gi|8547237|gb|AAF76312.1|AF220603_4   (AF220603) Prf   -193.3      0.011   1
gi|5702196|gb|AAD47197.1|AF107293_1   (AF107293) rust  -194.1      0.012   1
gi|2443884|gb|AAB71477.1|             (AC002294) Simi  -194.4      0.012   1
gi|7489454|pir||T00020                bacterial bligh  -194.5      0.012   1
gi|8118138|gb|AAF72909.1|             (AF230827) resi  -194.6      0.013   1
gi|14348613|gb|AAK61315.1|AF306499_1  (AF306499) NBS-  -195.1      0.013   1
gi|4092774|gb|AAC99466.1|             (AF105140) dise  -195.7      0.014   1
gi|12321052|gb|AAG50648.1|AC082643_12 (AC082643) dise  -195.7      0.014   1
gi|15088546|gb|AAK84082.1|AF326781_3  (AF326781) puta  -195.9      0.015   1
gi|13937084|gb|AAK50041.1|AF363796_1  (AF363796) puta  -196.4      0.016   1
gi|5817345|gb|AAD52716.1|AF123700_1   (AF123700) puta  -197.4      0.017   1
gi|8809609|dbj|BAA97160.1|            (AB018117) NBS/  -197.4      0.018   1
gi|7489234|pir||T07766                disease resista  -198.0      0.019   1
gi|14279468|gb|AAK58606.1|AF271293_1  (AF271293) nucl  -198.1      0.019   1
gi|7488989|pir||T07589                disease resista  -198.1      0.019   1
gi|8547232|gb|AAF76308.1|             (AF220602) Prf   -198.1      0.019   1
gi|6520229|dbj|BAA87956.1|            (AB028231) PRM1  -198.1      0.019   1
gi|13487351|gb|AAK27507.1|            (AF344309) rust  -198.2      0.019   1
gi|12744955|gb|AAK06858.1|            (AF342992) rust  -198.5       0.02   1
gi|4092771|gb|AAC99464.1|             (AF105139) dise  -198.9      0.021   1
gi|13310480|gb|AAK18308.1|            (AF342991) rust  -199.1      0.022   1
gi|6633843|gb|AAF19702.1|AC008047_9   (AC008047) F2K1  -199.2      0.022   1
gi|12324358|gb|AAG52150.1|AC022355_11 (AC022355) hypo  -199.2      0.022   1
gi|12744957|gb|AAK06859.1|            (AF342993) rust  -199.3      0.022   1
gi|3056599|gb|AAC13910.1|AAC13910     (AC004255) T1F9  -200.2      0.024   1
gi|7489349|pir||T30560                resistance prot  -200.3      0.025   1
gi|12744961|gb|AAK06860.1|            (AF342996) rust  -201.3      0.028   1
gi|8118130|gb|AAF72906.1|             (AF230823) resi  -201.9       0.03   1
gi|6633842|gb|AAF19701.1|AC008047_8   (AC008047) F2K1  -202.0       0.03   1
gi|5817351|gb|AAD52719.1|AF123703_1   (AF123703) puta  -202.3      0.032   1
gi|4680207|gb|AAD27570.1|AF114171_11  (AF114171) dise  -203.0      0.034   1
gi|5231014|gb|AAD41050.1|AF122982_1   (AF122982) NBS/  -203.0      0.034   1
gi|13487349|gb|AAK27506.1|            (AF344308) rust  -203.7      0.037   1
gi|7489351|pir||T30563                resistance prot  -204.0      0.038   1
gi|8118185|gb|AAF72928.1|             (AF230851) resi  -204.3       0.04   1
gi|7489509|pir||T02226                NBS-LRR type re  -204.6      0.042   1
gi|11357253|pir||T48898               disease resista  -204.9      0.043   1
gi|7489354|pir||T30564                resistance prot  -205.4      0.045   1
gi|9758140|dbj|BAB08632.1|            (AB010700) dise  -205.4      0.046   1
gi|6606266|gb|AAF19148.1|AF158634_1   (AF158634) Vrga  -205.6      0.046   1
gi|12744963|gb|AAK06861.1|            (AF342997) rust  -206.2       0.05   1
gi|1931650|gb|AAB65485.1|             (U95973) diseas  -206.4      0.051   1
gi|3075464|gb|AAC14553.1|             (AF039377) puta  -207.7       0.06   1
gi|8118154|gb|AAF72916.1|             (AF230835) resi  -208.6      0.067   1
gi|6983863|dbj|BAA90798.1|            (AP001168) Simi  -209.0       0.07   1
gi|8118199|gb|AAF72933.1|             (AF230859) resi  -209.2      0.072   1
gi|1361985|pir||A57072                disease resista  -209.4      0.073   1
gi|8118136|gb|AAF72908.1|             (AF230826) resi  -209.5      0.075   1
gi|10440622|gb|AAG16860.1|AC069145_9  (AC069145) puta  -209.7      0.076   1
gi|9758141|dbj|BAB08633.1|            (AB010700) dise  -209.9      0.078   1
gi|12321041|gb|AAG50637.1|AC082643_1  (AC082643) dise  -210.7      0.085   1
gi|8118188|gb|AAF72929.1|             (AF230853) resi  -211.2      0.091   1
gi|5817339|gb|AAD52713.1|AF123697_1   (AF123697) puta  -211.5      0.094   1
gi|12325366|gb|AAG52625.1|AC024261_12 (AC024261) hypo  -211.7      0.096   1
gi|11994217|dbj|BAB01339.1|           (AB028617) dise  -212.1        0.1   1
gi|10177352|dbj|BAB10695.1|           (AB015468) dise  -212.6       0.11   1
gi|6721550|dbj|BAA89580.1|            (AP001073) Simi  -213.6       0.12   1
gi|7489350|pir||T30562                resistance prot  -213.9       0.13   1
gi|8118117|gb|AAF72900.1|             (AF230817) resi  -214.3       0.13   1
gi|8118113|gb|AAF72898.1|             (AF230815) resi  -215.8       0.16   1
gi|6721549|dbj|BAA89579.1|            (AP001073) Simi  -215.9       0.16   1
gi|8118205|gb|AAF72936.1|             (AF230862) resi  -216.0       0.16   1
gi|8118110|gb|AAF72897.1|             (AF230814) resi  -216.0       0.16   1
gi|8118208|gb|AAF72937.1|             (AF230863) resi  -216.0       0.16   1
gi|7489516|pir||T03031                NBS-LRR type re  -216.2       0.16   1
gi|9858468|gb|AAG01047.1|             (AF175391) resi  -216.6       0.17   1
gi|14475935|gb|AAK62782.1|AC027036_3  (AC027036) resi  -217.5       0.19   1
gi|6520173|dbj|BAA87943.1|            (AB028203) PRM1  -218.0        0.2   1
gi|14475950|gb|AAK62797.1|AC027036_18 (AC027036) vira  -218.0        0.2   1
gi|13310454|gb|AAK18296.1|AF338962_1  (AF338962) dise  -218.1       0.21   1
gi|8118201|gb|AAF72934.1|             (AF230860) resi  -220.3       0.27   1
gi|7110565|gb|AAF36987.1|AF234174_1   (AF234174) vira  -220.7       0.28   1
gi|7489238|pir||T07770                disease resista  -220.8       0.29   1
gi|8118133|gb|AAF72907.1|             (AF230825) resi  -222.1       0.33   1
gi|8118193|gb|AAF72931.1|             (AF230856) resi  -224.0       0.42   1
gi|11357252|pir||T48899               disease resista  -224.4       0.44   1
gi|13957628|gb|AAK50583.1|AC084404_8  (AC084404) puta  -224.4       0.44   1
gi|8118196|gb|AAF72932.1|             (AF230857) resi  -225.8       0.52   1
gi|13093492|emb|CAC30706.1|           (AL583923) poss  -226.1       0.54   1
gi|7488088|pir||F71408                probable diseas  -226.7       0.58   1
gi|6649097|gb|AAF21368.1|AF146275_1   (AF146275) resi  -227.3       0.62   1
gi|7478889|pir||E70834                probable regula  -229.4       0.79   1
gi|13879898|gb|AAK44621.1|            (AE006944) tran  -229.4       0.79   1
gi|7769860|gb|AAF69538.1|AC008007_13  (AC008007) F12M  -230.4       0.89   1
gi|6721547|dbj|BAA89577.1|            (AP001073) Simi  -230.8       0.94   1
gi|8118121|gb|AAF72902.1|             (AF230819) resi  -231.3          1   1
gi|3411225|gb|AAC31552.1|             (AF078873) NBS-  -231.9        1.1   1
gi|9558523|dbj|BAB03441.1|            (AP002817) ESTs  -232.2        1.1   1
gi|14194911|sp|Q9PK50|LON_CHLMU       ATP-DEPENDENT P  -233.5        1.3   1
gi|3411227|gb|AAC31553.1|             (AF078874) NBS-  -233.8        1.3   1
gi|6225632|sp|O84348|LON_CHLTR        ATP-DEPENDENT P  -234.3        1.4   1
gi|5080812|gb|AAD39321.1|AC007258_10  (AC007258) Puta  -234.3        1.4   1
gi|11691821|emb|CAC18690.1|           (AL451182) puta  -235.8        1.7   1
gi|7489393|pir||T04381                NBS-LRR type re  -236.9        1.9   1
gi|8778746|gb|AAF79754.1|AC009317_13  (AC009317) T30E  -236.9        1.9   1
gi|8118166|gb|AAF72921.1|             (AF230841) resi  -237.4          2   1
gi|7489400|pir||T04393                NBS-LRR type re  -237.4        2.1   1
gi|12642090|gb|AAK00132.1|AF207842_1  (AF207842) Pi-t  -237.6        2.1   1
gi|7489401|pir||T04394                NBS-LRR type re  -238.4        2.3   1
gi|5869874|emb|CAB55581.1|            (AJ243005) apop  -239.1        2.5   1
gi|8118108|gb|AAF72896.1|             (AF230813) resi  -239.5        2.6   1
gi|8118128|gb|AAF72905.1|             (AF230822) resi  -239.6        2.7   1
gi|3982622|gb|AAC83563.1|             (AF056155) dise  -240.0        2.8   1
gi|5869886|emb|CAB55587.1|            (AJ243011) prot  -240.8        3.1   1
gi|6857755|ref|NP_033814.1|           apoptotic prote  -240.9        3.1   1
gi|8118123|gb|AAF72903.1|             (AF230820) resi  -241.6        3.4   1
gi|4502123|ref|NP_001151.1|           apoptotic prote  -242.0        3.5   1
gi|14764847|ref|XP_039639.1|          apoptotic prote  -242.0        3.5   1
gi|7108333|ref|NP_037361.1|           apoptotic prote  -242.0        3.5   1
gi|5869870|emb|CAB55579.1|            (AJ243003) apop  -242.0        3.5   1
gi|5869872|emb|CAB55580.1|            (AJ243004) apop  -242.0        3.5   1
gi|5869876|emb|CAB55582.1|            (AJ243006) apop  -242.0        3.5   1
gi|5869880|emb|CAB55584.1|            (AJ243008) apop  -242.0        3.5   1
gi|5869882|emb|CAB55585.1|            (AJ243009) apop  -242.0        3.5   1
gi|5921467|emb|CAB56462.1|            (AJ243107) apop  -242.0        3.5   1
gi|14764839|ref|XP_006885.4|          8264 [Homo sapi  -242.0        3.5   1
gi|14764851|ref|XP_039640.1|          8266 [Homo sapi  -242.0        3.5   1
gi|15023171|gb|AAK78307.1|AE007547_4  (AE007547) ATPa  -243.1          4   1
gi|13027436|ref|NP_076469.1|          apoptotic prote  -243.1        4.1   1
gi|7489514|pir||T02236                NBS-LRR type re  -243.2        4.1   1
gi|5702198|gb|AAD47198.1|AF107294_1   (AF107294) rust  -243.6        4.3   1
gi|8118212|gb|AAF72939.1|             (AF230865) resi  -243.7        4.3   1
gi|3982618|gb|AAC83561.1|             (AF056153) dise  -245.9        5.7   1
gi|4234955|gb|AAD13037.1|             (AF098971) NBS-  -245.9        5.7   1
gi|113491|sp|P25941|AFSR_STRCO        REGULATORY PROT  -246.0        5.7   1
gi|7478876|pir||G70868                probable regula  -246.1        5.8   1
gi|13882292|gb|AAK46866.1|            (AE007093) tran  -246.1        5.8   1
gi|8099241|gb|AAF72089.1|AC025098_23  (AC025098) Bact  -246.5        6.1   1
gi|14028977|gb|AAK52518.1|AC079128_1  (AC079128) Puta  -246.5        6.1   1
gi|7635936|emb|CAB88433.1|            (AL353815) regu  -246.5        6.1   1
gi|5821369|dbj|BAA83790.1|            (AB025225) AfsR  -246.6        6.1   1
gi|9858469|gb|AAG01048.1|             (AF175391) resi  -246.9        6.4   1
gi|4587240|dbj|BAA76678.1|            (AB022164) A1.1  -248.7        7.9   1
gi|5869878|emb|CAB55583.1|            (AJ243007) apop  -249.3        8.5   1
gi|8118210|gb|AAF72938.1|             (AF230864) resi  -249.4        8.5   1
gi|5869884|emb|CAB55586.1|            (AJ243010) apop  -250.6        9.9   1

Parsed for domains:
Sequence                              Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------                              ------- ----- -----    ----- -----      -----  -------
gi|6227009|gb|AAF06045.1|AC009513_1     1/1     202   599 ..     1   430 []   923.1 9.3e-273
gi|9758812|dbj|BAB09346.1|              1/1      20   421 ..     1   430 []   920.6 5.4e-272
gi|8953387|emb|CAB96660.1|              1/1     231   621 ..     1   430 []   903.8 6.2e-267
gi|7488217|pir||F71405                  1/1     139   524 ..     1   430 []   902.7 1.3e-266
gi|10178009|dbj|BAB11461.1|             1/1     181   570 ..     1   430 []   900.1 8.3e-266
gi|10178243|dbj|BAB11675.1|             1/1     179   574 ..     1   430 []   893.8 6.3e-264
gi|8843884|dbj|BAA97410.1|              1/1     181   570 ..     1   430 []   892.6 1.5e-263
gi|6598711|gb|AAD25848.2|AC007197_1     1/1     225   612 ..     1   430 []   891.0 4.4e-263
gi|9759538|dbj|BAB11004.1|              1/1     183   568 ..     1   430 []   889.5 1.2e-262
gi|8843883|dbj|BAA97409.1|              1/1     138   526 ..     1   430 []   886.3 1.2e-261
gi|12324940|gb|AAG52419.1|AC011622_7    1/1     181   567 ..     1   430 []   884.8 3.2e-261
gi|9757889|dbj|BAB08396.1|              1/1     185   579 ..     1   430 []   881.8 2.6e-260
gi|7486351|pir||T01916                  1/1     179   571 ..     1   430 []   881.8 2.6e-260
gi|7487334|pir||T08196                  1/1     179   571 ..     1   430 []   881.8 2.6e-260
gi|3757516|gb|AAC64218.1|               1/1     180   565 ..     1   430 []   881.5 3.2e-260
gi|9758866|dbj|BAB09448.1|              1/1     226   623 ..     1   430 []   881.0 4.7e-260
gi|10177970|dbj|BAB11353.1|             1/1     180   559 ..     1   430 []   880.3 7.5e-260
gi|6721163|gb|AAF26791.1|AC016829_15    1/1     232   623 ..     1   430 []   877.3   6e-259
gi|12325006|gb|AAG52448.1|AC010852_5    1/1     182   571 ..     1   430 []   877.0 7.4e-259
gi|6692110|gb|AAF24575.1|AC007764_17    1/1     380   764 ..     1   430 []   875.3 2.3e-258
gi|10177582|dbj|BAB10813.1|             1/1     181   572 ..     1   430 []   871.2   4e-257
gi|7485310|pir||T14515                  1/1     176   573 ..     1   430 []   864.7 3.8e-255
gi|10178008|dbj|BAB11460.1|             1/1     179   568 ..     1   430 []   864.6   4e-255
gi|10177708|dbj|BAB11082.1|             1/1     177   570 ..     1   430 []   864.5 4.3e-255
gi|10177707|dbj|BAB11081.1|             1/1     177   571 ..     1   430 []   862.2 2.1e-254
gi|9279731|dbj|BAB01321.1|              1/1     197   588 ..     1   430 []   860.4 7.1e-254
gi|9954758|gb|AAG09109.1|AC009323_20    1/1     183   570 ..     1   430 []   860.2 8.5e-254
gi|10177584|dbj|BAB10815.1|             1/1     182   572 ..     1   430 []   860.0 9.7e-254
gi|9758704|dbj|BAB09158.1|              1/1     208   598 ..     1   430 []   854.2 5.3e-252
gi|12324938|gb|AAG52417.1|AC011622_5    1/1     210   600 ..     1   430 []   853.3   1e-251
gi|12322541|gb|AAG51270.1|AC027135_11   1/1     178   572 ..     1   430 []   849.9   1e-250
gi|12597847|gb|AAG60157.1|AC074360_22   1/1     178   572 ..     1   430 []   849.9   1e-250
gi|3860163|gb|AAC72977.1|               1/1     221   611 ..     1   430 []   848.5 2.9e-250
gi|9758205|dbj|BAB08679.1|              1/1     180   565 ..     1   430 []   845.2 2.7e-249
gi|10177588|dbj|BAB10819.1|             1/1     177   572 ..     1   430 []   842.3   2e-248
gi|9758062|dbj|BAB08641.1|              1/1     173   556 ..     1   430 []   841.9 2.7e-248
gi|10177589|dbj|BAB10820.1|             1/1     216   611 ..     1   430 []   841.6 3.3e-248
gi|11357256|pir||T48928                 1/1     267   655 ..     1   430 []   841.5 3.6e-248
gi|10176947|dbj|BAB10096.1|             1/1     181   572 ..     1   430 []   841.3 4.1e-248
gi|12325008|gb|AAG52450.1|AC010852_7    1/1     185   566 ..     1   430 []   840.3 8.3e-248
gi|3860165|gb|AAC72978.1|               1/1     254   643 ..     1   430 []   838.1 3.6e-247
gi|11357250|pir||T47442                 1/1     263   658 ..     1   430 []   836.1 1.5e-246
gi|10177586|dbj|BAB10817.1|             1/1     177   571 ..     1   430 []   834.6 4.2e-246
gi|3860167|gb|AAC72979.1|               1/1     250   643 ..     1   430 []   829.7 1.3e-244
gi|11357251|pir||T47438                 1/1     263   680 ..     1   430 []   828.8 2.3e-244
gi|12324936|gb|AAG52415.1|AC011622_3    1/1     186   572 ..     1   430 []   822.6 1.8e-242
gi|5302807|emb|CAB46048.1|              1/1     183   565 ..     1   430 []   821.1 4.8e-242
gi|5302803|emb|CAB46044.1|              1/1     178   561 ..     1   430 []   813.4   1e-239
gi|7485210|pir||H71436                  1/1     178   561 ..     1   430 []   813.4   1e-239
gi|11357260|pir||T47430                 1/1     208   599 ..     1   430 []   812.9 1.5e-239
gi|12323031|gb|AAG51508.1|AC058785_11   1/1     181   566 ..     1   430 []   808.3 3.5e-238
gi|6449046|gb|AAF08790.1|               1/1     183   567 ..     1   430 []   801.8 3.3e-236
gi|12597786|gb|AAG60098.1|AC073178_9    1/1     247   637 ..     1   430 []   801.5 3.9e-236
gi|14532598|gb|AAK64027.1|              1/1     249   639 ..     1   430 []   801.5 3.9e-236
gi|7488168|pir||C71436                  1/1     180   566 ..     1   430 []   800.1   1e-235
gi|5302806|emb|CAB46047.1|              1/1     175   565 ..     1   430 []   798.3 3.5e-235
gi|7488173|pir||G71437                  1/1     182   572 ..     1   430 []   796.6 1.1e-234
gi|5302805|emb|CAB46046.1|              1/1     176   561 ..     1   430 []   794.3 5.7e-234
gi|9954759|gb|AAG09110.1|AC009323_21    1/1     181   571 ..     1   430 []   791.4 4.4e-233
gi|12323030|gb|AAG51507.1|AC058785_10   1/1     181   571 ..     1   430 []   791.4 4.4e-233
gi|10177430|dbj|BAB10522.1|             1/1     180   534 ..     1   430 []   768.4 3.5e-226
gi|7488170|pir||D71437                  2/2    1304  1713 ..     1   430 []   761.9 3.3e-224
gi|7488170|pir||D71437                  1/2      18   386 ..     1   430 []   760.6 8.1e-224
gi|5302808|emb|CAB46049.1|              1/1     182   548 ..     1   430 []   752.2 2.7e-221
gi|7488166|pir||A71437                  1/1     179   546 ..     1   430 []   740.9 6.9e-218
gi|7488167|pir||B71437                  1/1     212   575 ..     1   430 []   716.7 1.3e-210
gi|7485134|pir||E71436                  1/1      18   383 ..     1   430 []   702.2   3e-206
gi|7268442|emb|CAB80962.1|              1/1     179   529 ..     1   430 []   697.8 6.3e-205
gi|8843806|dbj|BAA97354.1|              1/1     117   478 ..     1   430 []   665.8 2.8e-195
gi|9759045|dbj|BAB09567.1|              1/1     181   567 ..     1   430 []   513.1 2.5e-149
gi|10944739|emb|CAC14089.1|             1/1     176   522 ..     1   430 []   428.5 7.5e-124
gi|7488174|pir||A71438                  1/1     403   742 ..     1   430 []   413.5 2.4e-119
gi|6721164|gb|AAF26792.1|AC016829_16    1/1     209   505 .]     1   430 []   396.0 4.5e-114
gi|5302809|emb|CAB46050.1|              1/1     176   438 ..     1   430 []   382.0 7.7e-110
gi|9758876|dbj|BAB09430.1|              1/1     181   569 ..     1   430 []   372.6   5e-107
gi|8778469|gb|AAF79477.1|AC022492_21    1/1     179   569 ..     1   430 []   351.1 1.5e-100
gi|5903073|gb|AAD55631.1|AC008017_4     1/1     153   527 ..     1   430 []   345.8  5.8e-99
gi|9758746|dbj|BAB09118.1|              1/1     180   562 ..     1   430 []   345.5  7.4e-99
gi|7484921|pir||T06143                  1/2     178   532 ..     1   430 []   325.5  7.5e-93
gi|12322617|gb|AAG51311.1|AC026480_18   1/1     194   429 .]     1   430 []   311.2  1.6e-88
gi|5903075|gb|AAD55633.1|AC008017_6     1/1     179   574 ..     1   430 []   302.4    7e-86
gi|3947735|emb|CAA08798.1|              1/1     196   571 ..     1   430 []   290.0  3.6e-82
gi|12056928|gb|AAG48132.1|AF322632_1    1/1     188   575 ..     1   430 []   288.9  7.8e-82
gi|1086263|pir||A54810                  1/1     187   570 ..     1   430 []   265.9  6.8e-75
gi|9965103|gb|AAG09951.1|               1/1     172   552 ..     1   430 []   265.4  9.4e-75
gi|7484909|pir||T06608                  1/1     182   580 ..     1   430 []   264.9  1.4e-74
gi|7267585|emb|CAB78066.1|              1/1     181   557 ..     1   430 []   247.9  1.8e-69
gi|10178211|dbj|BAB11635.1|             1/1     194   571 ..     1   430 []   245.2  1.1e-68
gi|9965107|gb|AAG09953.1|AF175398_1     1/1      16   393 ..     1   430 []   231.4  1.6e-64
gi|12003378|gb|AAG43546.1|AF211528_1    1/1     186   535 ..     1   430 []   211.5  1.5e-58
gi|9965105|gb|AAG09952.1|AF175389_1     1/1     126   512 ..     1   430 []   209.8    5e-58
gi|12056930|gb|AAG48133.1|AF322633_1    1/1     182   522 .]     1   430 []   208.3  1.5e-57
gi|7267578|emb|CAB78059.1|              1/1       1   336 [.     1   430 []   201.3  1.8e-55
gi|7484912|pir||T06144                  1/1     197   575 ..     1   430 []   199.2  8.1e-55
gi|3947733|emb|CAA08797.1|              1/1     194   533 .]     1   430 []   174.4  2.3e-47
gi|7488375|pir||T04583                  2/2     580   973 ..     1   430 []   172.4  9.2e-47
gi|7488903|pir||T18548                  1/1     250   644 ..     1   430 []   166.2  6.9e-45
gi|10177497|dbj|BAB10888.1|             1/1     141   534 ..     1   430 []   165.1  1.4e-44
gi|10121909|gb|AAG13419.1|AC000348_16   1/1     393   759 ..     1   430 []   165.1  1.4e-44
gi|12321343|gb|AAG50739.1|AC079733_7    1/1       9   302 ..     1   430 []   162.6  8.3e-44
gi|4588054|gb|AAD25968.1|AF093641_2     1/1     235   620 ..     1   430 []   159.9  5.4e-43
gi|7488902|pir||T18547                  1/1     235   620 ..     1   430 []   159.4  7.6e-43
gi|7488901|pir||T18546                  1/1     235   620 ..     1   430 []   159.4  7.6e-43
gi|4588064|gb|AAD25973.1|AF093646_1     1/1     235   620 ..     1   430 []   159.4  7.6e-43
gi|4588048|gb|AAD25965.1|AF093638_1     1/1     235   628 ..     1   430 []   157.9  2.2e-42
gi|4588066|gb|AAD25974.1|AF093647_1     1/1     235   621 ..     1   430 []   156.4  5.9e-42
gi|4588068|gb|AAD25975.1|AF093648_2     1/1     235   621 ..     1   430 []   156.3  6.5e-42
gi|4588056|gb|AAD25969.1|AF093642_1     1/1     235   621 ..     1   430 []   153.4  4.8e-41
gi|4588070|gb|AAD25976.1|AF093649_1     1/1     235   621 ..     1   430 []   152.9    7e-41
gi|10176997|dbj|BAB10247.1|             1/1     150   541 ..     1   430 []   152.2  1.1e-40
gi|4588060|gb|AAD25971.1|AF093644_1     1/1     235   629 ..     1   430 []   151.2  2.2e-40
gi|7484913|pir||T06145                  1/1     138   520 ..     1   430 []   150.9  2.7e-40
gi|4588052|gb|AAD25967.1|AF093640_1     1/1     235   629 ..     1   430 []   149.2    9e-40
gi|4588050|gb|AAD25966.1|AF093639_1     1/1     235   622 ..     1   430 []   149.0    1e-39
gi|10121908|gb|AAG13418.1|AC000348_15   1/1     331   701 ..     1   430 []   144.5  2.4e-38
gi|11357257|pir||T45787                 1/1     154   535 ..     1   430 []   139.1  9.5e-37
gi|4588062|gb|AAD25972.1|AF093645_1     1/1     235   629 ..     1   430 []   135.7    1e-35
gi|11358639|pir||T45788                 1/1     204   589 ..     1   430 []   132.5  9.2e-35
gi|7488376|pir||T04584                  1/1     215   589 ..     1   430 []   127.8  2.4e-33
gi|10177890|dbj|BAB11222.1|             1/1     180   569 ..     1   430 []   121.3  2.3e-31
gi|13509217|emb|CAC35328.1|             1/1     209   593 ..     1   430 []   119.2  9.3e-31
gi|7484910|pir||T06609                  1/1     811  1191 ..     1   430 []   119.2  9.5e-31
gi|13509215|emb|CAC35327.1|             1/1     208   590 ..     1   430 []   118.6  1.4e-30
gi|13509211|emb|CAC35325.1|             1/1     209   593 ..     1   430 []   118.5  1.5e-30
gi|13509225|emb|CAC35332.1|             1/1     209   593 ..     1   430 []   115.9  9.2e-30
gi|11357255|pir||T51141                 1/1     206   597 ..     1   430 []   115.6  1.1e-29
gi|5823587|emb|CAB53785.1|              1/1     206   597 ..     1   430 []   115.6  1.1e-29
gi|11357254|pir||T51140                 1/1     206   597 ..     1   430 []   114.0  3.6e-29
gi|2660663|gb|AAC79134.1|               1/1     257   638 ..     1   430 []   106.7  5.5e-27
gi|13517483|gb|AAK28812.1|AF310968_1    1/1     193   623 ..     1   430 []   105.3  1.5e-26
gi|9759606|dbj|BAB11394.1|              1/1     165   545 ..     1   430 []   104.0  3.6e-26
gi|11761682|gb|AAG40141.1|AF209498_1    1/1       1   173 []     1   430 []   103.7  4.5e-26
gi|13509209|emb|CAC35323.1|             1/1     209   591 ..     1   430 []   103.5    5e-26
gi|13509223|emb|CAC35331.1|             1/1     209   591 ..     1   430 []   103.5    5e-26
gi|13517477|gb|AAK28810.1|AF310964_1    1/1     193   624 ..     1   430 []   102.5  9.9e-26
gi|13517480|gb|AAK28811.1|AF310966_1    1/1     193   624 ..     1   430 []   102.5    1e-25
gi|15028063|gb|AAK76562.1|              1/1       2   337 .]     1   430 []   100.4  4.5e-25
gi|13517469|gb|AAK28806.1|AF310960_2    1/1     193   624 ..     1   430 []    97.1  4.4e-24
gi|10177889|dbj|BAB11221.1|             1/1     202   600 ..     1   430 []    93.3    6e-23
gi|9758979|dbj|BAB09489.1|              1/1     205   596 ..     1   430 []    92.4  1.1e-22
gi|7488375|pir||T04583                  1/2     263   557 ..     1   430 []    91.7  1.9e-22
gi|13509213|emb|CAC35326.1|             1/1     209   600 ..     1   430 []    90.0  6.1e-22
gi|6598361|gb|AAF18599.1|AC002354_8     1/1      26   402 ..     1   430 []    89.3  9.3e-22
gi|13509207|emb|CAC35321.1|             1/1     209   600 ..     1   430 []    87.3  3.8e-21
gi|13509234|emb|CAC35337.1|             1/1     209   600 ..     1   430 []    87.2    4e-21
gi|13509238|emb|CAC35339.1|             1/1     209   600 ..     1   430 []    86.6  6.3e-21
gi|13509236|emb|CAC35338.1|             1/1     209   600 ..     1   430 []    85.1  1.7e-20
gi|13517474|gb|AAK28809.1|AF310962_1    1/1     178   609 ..     1   430 []    84.9  2.1e-20
gi|13509219|emb|CAC35329.1|             1/1     209   600 ..     1   430 []    83.8  4.3e-20
gi|13509221|emb|CAC35330.1|             1/1     209   600 ..     1   430 []    83.6    5e-20
gi|13517464|gb|AAK28803.1|AF310958_1    1/1     180   610 ..     1   430 []    81.4  2.3e-19
gi|13517466|gb|AAK28804.1|AF310959_1    1/1     178   608 ..     1   430 []    81.4  2.3e-19
gi|6598362|gb|AAF18600.1|AC002354_9     1/1     122   521 ..     1   430 []    79.9  6.7e-19
gi|13509227|emb|CAC35333.1|             1/1     209   600 ..     1   430 []    79.2  1.1e-18
gi|9759605|dbj|BAB11393.1|              1/1     210   598 ..     1   430 []    78.2  2.1e-18
gi|13517468|gb|AAK28805.1|AF310960_1    1/1     180   607 ..     1   430 []    76.9  5.3e-18
gi|13517472|gb|AAK28808.1|AF310961_1    1/1     180   607 ..     1   430 []    76.9  5.3e-18
gi|13509229|emb|CAC35334.1|             1/1     209   600 ..     1   430 []    76.8  5.7e-18
gi|8778463|gb|AAF79471.1|AC022492_15    1/1     173   508 ..     1   430 []    70.9  2.4e-16
gi|9759608|dbj|BAB11396.1|              1/1     222   596 ..     1   430 []    50.4  2.7e-15
gi|8843808|dbj|BAA97356.1|              1/1     176   459 .]     1   430 []    49.6    3e-15
gi|7484921|pir||T06143                  2/2     694  1041 ..     1   430 []    27.4  4.2e-14
gi|5903074|gb|AAD55632.1|AC008017_5     1/1     165   421 ..     1   430 []    25.3  5.5e-14
gi|7267584|emb|CAB78065.1|              1/1     203   457 .]     1   430 []    23.9  6.4e-14
gi|9758877|dbj|BAB09431.1|              1/1     437   669 .]     1   430 []    12.0  2.7e-13
gi|9858478|gb|AAG01052.1|AF175395_1     1/1     185   435 .]     1   430 []     9.9  3.4e-13
gi|9858476|gb|AAG01051.1|AF175394_1     1/1     183   438 .]     1   430 []    -3.4  1.7e-12
gi|7484914|pir||T06146                  1/1     200   602 ..     1   430 []   -19.8  1.2e-11
gi|5903076|gb|AAD55634.1|AC008017_7     1/1     247   507 ..     1   430 []   -25.8  2.4e-11
gi|4100321|gb|AAD00827.1|               1/1       1   209 []     1   430 []   -28.7  3.4e-11
gi|3176745|gb|AAC50026.1|               1/1       1   146 []     1   430 []   -53.5  6.5e-10
gi|13310478|gb|AAK18307.1|AF338975_1    1/1       1   129 []     1   430 []   -54.3  7.1e-10
gi|13310476|gb|AAK18306.1|AF338974_1    1/1       1   129 []     1   430 []   -55.5  8.1e-10
gi|13310457|gb|AAK18297.1|AF338964_1    1/1       1   129 []     1   430 []   -62.4  1.9e-09
gi|11761674|gb|AAG40138.1|AF209493_1    1/1       1   171 []     1   430 []   -68.2  3.7e-09
gi|11761672|gb|AAG40137.1|AF209492_1    1/1       1   165 []     1   430 []   -69.4  4.3e-09
gi|7484488|pir||T08068                  1/1       1   264 []     1   430 []   -72.7  6.3e-09
gi|6648975|gb|AAF21316.1|               1/1       1   204 []     1   430 []  -102.7  2.2e-07
gi|6648973|gb|AAF21315.1|               1/1       1   205 []     1   430 []  -103.9  2.6e-07
gi|6648977|gb|AAF21317.1|AF121437_1     1/1       1   209 []     1   430 []  -108.1  4.3e-07
gi|5903078|gb|AAD55636.1|AC008017_9     1/1     208   414 .]     1   430 []  -110.1  5.4e-07
gi|7488668|pir||T08833                  1/1       1   170 []     1   430 []  -114.3  8.9e-07
gi|5903084|gb|AAD55642.1|AC008017_15    1/1     181   378 ..     1   430 []  -114.3  8.9e-07
gi|2852684|gb|AAC02202.1|               1/1     161   538 ..     1   430 []  -116.4  1.1e-06
gi|7107244|gb|AAF36336.1|AF186628_1     1/1       1   170 []     1   430 []  -116.7  1.2e-06
gi|7107236|gb|AAF36332.1|AF186624_1     1/1       1   170 []     1   430 []  -118.0  1.4e-06
gi|13937090|gb|AAK50044.1|AF363799_1    1/1       1   171 []     1   430 []  -118.8  1.5e-06
gi|13897754|gb|AAK48438.1|AF255462_1    1/1       1   170 []     1   430 []  -119.8  1.7e-06
gi|13194664|gb|AAK15497.1|AF325686_1    1/1       1   169 [.     1   430 []  -122.7  2.4e-06
gi|4519936|dbj|BAA75812.1|              1/1     166   548 ..     1   430 []  -128.7  4.9e-06
gi|4519938|dbj|BAA75813.1|              1/1     166   548 ..     1   430 []  -128.8    5e-06
gi|13897758|gb|AAK48440.1|AF255464_1    1/1       1   170 []     1   430 []  -129.1  5.2e-06
gi|7107238|gb|AAF36333.1|AF186625_1     1/1       1   170 []     1   430 []  -129.1  5.2e-06
gi|10176995|dbj|BAB10245.1|             1/1     164   536 ..     1   430 []  -129.5  5.5e-06
gi|7649322|emb|CAB88868.1|              1/1       1   170 [.     1   430 []  -130.2    6e-06
gi|5903079|gb|AAD55637.1|AC008017_10    1/1     180   363 .]     1   430 []  -130.8  6.4e-06
gi|7107254|gb|AAF36341.1|AF186633_1     1/1       1   169 []     1   430 []  -132.8    8e-06
gi|5903080|gb|AAD55638.1|AC008017_11    1/1     177   380 .]     1   430 []  -133.3  8.6e-06
gi|7489065|pir||T06403                  1/1     164   574 ..     1   430 []  -133.3  8.6e-06
gi|14589374|gb|AAK70629.1|AC091238_7    1/1     164   588 ..     1   430 []  -134.7    1e-05
gi|13194662|gb|AAK15496.1|AF325685_1    1/1       1   169 [.     1   430 []  -134.8    1e-05
gi|7488662|pir||T08819                  1/1       1   169 []     1   430 []  -136.8  1.3e-05
gi|13897756|gb|AAK48439.1|AF255463_1    1/1       1   168 []     1   430 []  -138.7  1.6e-05
gi|7107240|gb|AAF36334.1|AF186626_1     1/1       1   170 []     1   430 []  -141.3  2.2e-05
gi|7486805|pir||T05746                  1/1     122   503 ..     1   430 []  -141.5  2.3e-05
gi|7107242|gb|AAF36335.1|AF186627_1     1/1       1   170 []     1   430 []  -142.2  2.5e-05
gi|7107246|gb|AAF36337.1|AF186629_1     1/1       1   170 []     1   430 []  -143.0  2.7e-05
gi|7443914|pir||T06049                  1/1     152   535 ..     1   430 []  -145.5  3.6e-05
gi|13897764|gb|AAK48443.1|AF255467_1    1/1       1   169 []     1   430 []  -145.5  3.7e-05
gi|13897762|gb|AAK48442.1|AF255466_1    1/1       1   169 []     1   430 []  -146.3    4e-05
gi|8927667|gb|AAF82158.1|AC034256_22    1/1     226   605 ..     1   430 []  -146.8  4.3e-05
gi|7489239|pir||T07769                  1/1       1   154 []     1   430 []  -147.5  4.6e-05
gi|5903083|gb|AAD55641.1|AC008017_14    1/1     180   369 ..     1   430 []  -149.5  5.9e-05
gi|13937096|gb|AAK50047.1|AF363802_1    1/1       1   166 []     1   430 []  -150.2  6.4e-05
gi|4689223|gb|AAD27815.1|AF118127_1     1/1     165   539 ..     1   430 []  -150.2  6.4e-05
gi|14028983|gb|AAK52524.1|AC079128_7    1/1     167   570 ..     1   430 []  -150.7  6.8e-05
gi|13897752|gb|AAK48437.1|AF255461_1    1/1       1   166 [.     1   430 []  -152.8  8.7e-05
gi|13897760|gb|AAK48441.1|AF255465_1    1/1       1   166 [.     1   430 []  -152.8  8.7e-05
gi|6456755|gb|AAF09256.1|AF202179_1     1/1     150   526 ..     1   430 []  -153.2  9.2e-05
gi|7489066|pir||T06404                  1/1     165   505 ..     1   430 []  -153.3  9.2e-05
gi|4164087|gb|AAD08712.1|               1/1       1   165 []     1   430 []  -153.9    1e-04
gi|11357259|pir||T48468                 1/1     173   501 ..     1   430 []  -154.8  0.00011
gi|7649326|emb|CAB88870.1|              1/1       1   170 [.     1   430 []  -155.0  0.00011
gi|5911745|emb|CAB55838.1|              1/1     140   486 ..     1   430 []  -155.4  0.00012
gi|7489237|pir||T07767                  1/1       1   154 []     1   430 []  -155.5  0.00012
gi|3309619|gb|AAC26125.1|               1/1     157   535 ..     1   430 []  -156.4  0.00013
gi|11611778|gb|AAG39059.1|              1/1       1   167 []     1   430 []  -156.7  0.00014
gi|625973|pir||A54809                   1/1     155   559 ..     1   430 []  -157.5  0.00015
gi|12231681|gb|AAG49214.1|              1/1       1   155 []     1   430 []  -157.8  0.00016
gi|7488663|pir||T08820                  1/1       1   169 []     1   430 []  -158.4  0.00017
gi|10176752|dbj|BAB09983.1|             1/1     155   527 ..     1   430 []  -158.4  0.00017
gi|8809611|dbj|BAA97162.1|              1/1       2   365 ..     1   430 []  -158.7  0.00018
gi|7488669|pir||T08835                  1/1       1   170 []     1   430 []  -159.4  0.00019
gi|13377497|gb|AAK20736.1|              1/1     164   566 ..     1   430 []  -159.6  0.00019
gi|5669782|gb|AAD46471.1|AF108010_1     1/1     134   548 ..     1   430 []  -159.7   0.0002
gi|11278007|pir||T45590                 1/1     161   516 ..     1   430 []  -160.2  0.00021
gi|5918254|emb|CAB56299.1|              1/1     140   486 ..     1   430 []  -160.8  0.00023
gi|7649324|emb|CAB88869.1|              1/1       1   168 [.     1   430 []  -160.9  0.00023
gi|13897750|gb|AAK48436.1|AF255460_1    1/1       1   166 [.     1   430 []  -161.0  0.00023
gi|11278005|pir||T51185                 1/1     161   516 ..     1   430 []  -161.1  0.00023
gi|13872897|dbj|BAB44004.1|             1/1     171   557 ..     1   430 []  -161.5  0.00025
gi|6635380|gb|AAF19803.1|               1/1     156   549 ..     1   430 []  -162.3  0.00027
gi|7107266|gb|AAF36347.1|AF186639_1     1/1       1   169 []     1   430 []  -162.5  0.00028
gi|13702829|gb|AAK38505.1|AC087181_21   1/1     172   573 ..     1   430 []  -163.8  0.00032
gi|7443913|pir||T12979                  1/1     155   511 ..     1   430 []  -164.3  0.00034
gi|13937094|gb|AAK50046.1|AF363801_1    1/1       1   167 []     1   430 []  -164.8  0.00036
gi|15088547|gb|AAK84083.1|AF326781_9    1/1     150   494 ..     1   430 []  -164.9  0.00037
gi|7488665|pir||T08824                  1/1       1   169 []     1   430 []  -165.4  0.00039
gi|13937100|gb|AAK50049.1|AF363804_1    1/1       1   170 []     1   430 []  -165.9  0.00041
gi|7485661|pir||T05981                  1/1     175   579 ..     1   430 []  -166.0  0.00042
gi|13661831|gb|AAK38117.1|AF368301_1    1/1     155   548 ..     1   430 []  -166.4  0.00044
gi|7107260|gb|AAF36344.1|AF186636_1     1/1       1   170 []     1   430 []  -166.8  0.00046
gi|10177941|dbj|BAB11300.1|             1/1     154   550 ..     1   430 []  -167.7  0.00051
gi|7489353|pir||T30559                  1/1     150   543 ..     1   430 []  -168.6  0.00057
gi|6573285|dbj|BAA88265.1|              1/1     157   525 ..     1   430 []  -169.1   0.0006
gi|12321042|gb|AAG50638.1|AC082643_2    1/1     157   525 ..     1   430 []  -169.1   0.0006
gi|13937098|gb|AAK50048.1|AF363803_1    1/1       6   168 ..     1   430 []  -169.3  0.00062
gi|11278006|pir||T51186                 1/1     161   516 ..     1   430 []  -169.7  0.00065
gi|13377505|gb|AAK20742.1|              1/1     162   568 ..     1   430 []  -169.9  0.00067
gi|10998939|gb|AAG26078.1|AC069299_4    1/1     161   477 ..     1   430 []  -170.0  0.00068
gi|5524754|emb|CAB50786.1|              1/1     140   486 ..     1   430 []  -170.1  0.00068
gi|8778651|gb|AAF79659.1|AC025416_33    1/1    1052  1452 ..     1   430 []  -171.1  0.00077
gi|7488666|pir||T08831                  1/1       1   168 []     1   430 []  -171.3  0.00079
gi|7488661|pir||T08834                  1/1       1   167 []     1   430 []  -172.0  0.00086
gi|8809608|dbj|BAA97159.1|              1/1     152   549 ..     1   430 []  -173.0  0.00096
gi|7488667|pir||T08832                  1/1       1   191 []     1   430 []  -173.7   0.0011
gi|9758302|dbj|BAB08845.1|              1/1     155   572 ..     1   430 []  -173.9   0.0011
gi|8118179|gb|AAF72926.1|               1/1       2   156 .]     1   430 []  -174.3   0.0011
gi|7489235|pir||T07772                  1/1       2   153 .]     1   430 []  -174.5   0.0012
gi|13872900|dbj|BAB44007.1|             1/1     171   558 ..     1   430 []  -174.9   0.0012
gi|3309620|gb|AAC26126.1|               1/1     157   578 ..     1   430 []  -174.9   0.0012
gi|11990497|gb|AAG42167.1|AF149112_1    1/1     164   567 ..     1   430 []  -175.2   0.0012
gi|2129652|pir||S71195                  1/1     207   626 ..     1   430 []  -175.8   0.0013
gi|7484911|pir||T08416                  1/1     155   574 ..     1   430 []  -175.8   0.0013
gi|5817343|gb|AAD52715.1|AF123699_1     1/1       1   158 []     1   430 []  -176.8   0.0015
gi|13194660|gb|AAK15495.1|AF325684_1    1/1       1   171 []     1   430 []  -176.8   0.0015
gi|13872974|dbj|BAB44079.1|             1/1     173   557 ..     1   430 []  -177.3   0.0016
gi|8515762|gb|AAF76163.1|AF266747_1     1/1     140   486 ..     1   430 []  -177.9   0.0017
gi|13937086|gb|AAK50042.1|AF363797_1    1/1       1   169 []     1   430 []  -178.2   0.0018
gi|7415941|dbj|BAA93618.1|              1/1     427   820 ..     1   430 []  -178.7   0.0019
gi|8925783|gb|AAF81616.1|               1/1       1   159 []     1   430 []  -179.0    0.002
gi|5734781|gb|AAD50046.1|AC007980_11    1/1     163   559 ..     1   430 []  -179.5   0.0021
gi|7488664|pir||T08821                  1/1       1   170 []     1   430 []  -179.7   0.0021
gi|11990500|gb|AAG42168.1|              1/1     164   528 ..     1   430 []  -179.8   0.0022
gi|12330442|gb|AAG52758.1|AF263329_1    1/1       1   105 []     1   430 []  -179.8   0.0022
gi|4521190|dbj|BAA76281.1|              1/1     355   752 ..     1   430 []  -180.1   0.0022
gi|6172381|dbj|BAA85975.1|              1/1     401   798 ..     1   430 []  -180.1   0.0022
gi|7489348|pir||T08421                  1/1     158   544 ..     1   430 []  -180.1   0.0023
gi|14348622|gb|AAK61318.1|AF306502_1    1/1     183   601 ..     1   430 []  -180.3   0.0023
gi|8118168|gb|AAF72922.1|               1/1       1   153 [.     1   430 []  -180.5   0.0024
gi|9758146|dbj|BAB08703.1|              1/1     158   583 ..     1   430 []  -180.8   0.0024
gi|11612210|gb|AAG37354.1|              1/1     162   526 ..     1   430 []  -181.3   0.0026
gi|14348619|gb|AAK61317.1|AF306501_1    1/1     181   599 ..     1   430 []  -181.6   0.0027
gi|5669778|gb|AAD46469.1|AF108008_1     1/1     136   537 ..     1   430 []  -181.9   0.0028
gi|8118158|gb|AAF72917.1|               1/1       2   156 .]     1   430 []  -181.9   0.0028
gi|13937092|gb|AAK50045.1|AF363800_1    1/1       1   168 [.     1   430 []  -182.0   0.0028
gi|2852690|gb|AAC02205.1|               1/1       1   157 []     1   430 []  -182.3   0.0029
gi|13310471|gb|AAK18304.1|AF338971_1    1/1       1   127 []     1   430 []  -183.0   0.0032
gi|9965109|gb|AAG09954.1|AF175399_1     1/1     189   344 .]     1   430 []  -183.4   0.0033
gi|12957124|emb|CAC29241.1|             1/1     162   548 ..     1   430 []  -183.6   0.0034
gi|7443912|pir||T12977                  1/1     156   516 ..     1   430 []  -183.7   0.0034
gi|8118164|gb|AAF72920.1|               1/1       2   156 .]     1   430 []  -184.6   0.0038
gi|10177942|dbj|BAB11301.1|             1/1     153   547 ..     1   430 []  -185.3   0.0042
gi|7489501|pir||T02213                  1/1      36   422 ..     1   430 []  -185.6   0.0043
gi|8118171|gb|AAF72923.1|               1/1       2   154 ..     1   430 []  -186.8    0.005
gi|9858473|gb|AAG01049.1|               1/1       1   151 []     1   430 []  -188.2   0.0059
gi|11994216|dbj|BAB01338.1|             1/1     168   552 ..     1   430 []  -188.2   0.0059
gi|8118162|gb|AAF72919.1|               1/1       3   156 .]     1   430 []  -188.6   0.0062
gi|8517418|emb|CAB94290.1|              1/1       1   161 []     1   430 []  -188.8   0.0063
gi|14348616|gb|AAK61316.1|AF306500_1    1/1     176   594 ..     1   430 []  -188.9   0.0064
gi|8118183|gb|AAF72927.1|               1/1       1   156 []     1   430 []  -189.1   0.0065
gi|3426261|gb|AAC32253.1|               1/1     471   818 ..     1   430 []  -189.4   0.0068
gi|7489037|pir||T06267                  1/1     522   869 ..     1   430 []  -189.4   0.0068
gi|2443883|gb|AAB71476.1|               1/1     149   551 ..     1   430 []  -190.8    0.008
gi|7489071|pir||T07872                  1/1     471   832 ..     1   430 []  -191.3   0.0085
gi|4050014|gb|AAC97933.1|               1/1     522   883 ..     1   430 []  -191.3   0.0085
gi|7489072|pir||T06269                  1/1     522   860 ..     1   430 []  -191.8    0.009
gi|5454205|gb|AAD43620.1|AC005698_19    1/1     153   552 ..     1   430 []  -191.8    0.009
gi|3056600|gb|AAC13911.1|AAC13911       1/1      37   461 ..     1   430 []  -192.3   0.0095
gi|9711875|dbj|BAB07969.1|              1/1     329   686 ..     1   430 []  -192.8     0.01
gi|7443911|pir||T01899                  1/1     167   578 ..     1   430 []  -192.9     0.01
gi|7489236|pir||T07774                  1/1       1   150 []     1   430 []  -193.3    0.011
gi|7489352|pir||T30558                  1/1     165   548 ..     1   430 []  -193.3    0.011
gi|8547237|gb|AAF76312.1|AF220603_4     1/1    1090  1489 ..     1   430 []  -193.3    0.011
gi|5702196|gb|AAD47197.1|AF107293_1     1/1     189   562 ..     1   430 []  -194.1    0.012
gi|2443884|gb|AAB71477.1|               1/1     148   547 ..     1   430 []  -194.4    0.012
gi|7489454|pir||T00020                  1/1     299   673 ..     1   430 []  -194.5    0.012
gi|8118138|gb|AAF72909.1|               1/1       1   157 []     1   430 []  -194.6    0.013
gi|14348613|gb|AAK61315.1|AF306499_1    1/1     183   601 ..     1   430 []  -195.1    0.013
gi|4092774|gb|AAC99466.1|               1/1     174   591 ..     1   430 []  -195.7    0.014
gi|12321052|gb|AAG50648.1|AC082643_12   1/1     156   523 ..     1   430 []  -195.7    0.014
gi|15088546|gb|AAK84082.1|AF326781_3    1/1     389   762 ..     1   430 []  -195.9    0.015
gi|13937084|gb|AAK50041.1|AF363796_1    1/1       1   170 []     1   430 []  -196.4    0.016
gi|5817345|gb|AAD52716.1|AF123700_1     1/1       1   159 []     1   430 []  -197.4    0.017
gi|8809609|dbj|BAA97160.1|              1/1     163   534 ..     1   430 []  -197.4    0.018
gi|7489234|pir||T07766                  1/1       2   149 .]     1   430 []  -198.0    0.019
gi|14279468|gb|AAK58606.1|AF271293_1    1/1     168   581 ..     1   430 []  -198.1    0.019
gi|7488989|pir||T07589                  1/1    1089  1488 ..     1   430 []  -198.1    0.019
gi|8547232|gb|AAF76308.1|               1/1    1089  1488 ..     1   430 []  -198.1    0.019
gi|6520229|dbj|BAA87956.1|              1/1     134   550 ..     1   430 []  -198.1    0.019
gi|13487351|gb|AAK27507.1|              1/1     189   555 ..     1   430 []  -198.2    0.019
gi|12744955|gb|AAK06858.1|              1/1     189   557 ..     1   430 []  -198.5     0.02
gi|4092771|gb|AAC99464.1|               1/1     174   579 ..     1   430 []  -198.9    0.021
gi|13310480|gb|AAK18308.1|              1/1     187   559 ..     1   430 []  -199.1    0.022
gi|6633843|gb|AAF19702.1|AC008047_9     1/1     153   496 ..     1   430 []  -199.2    0.022
gi|12324358|gb|AAG52150.1|AC022355_11   1/1     153   496 ..     1   430 []  -199.2    0.022
gi|12744957|gb|AAK06859.1|              1/1     187   561 ..     1   430 []  -199.3    0.022
gi|3056599|gb|AAC13910.1|AAC13910       1/1     150   544 ..     1   430 []  -200.2    0.024
gi|7489349|pir||T30560                  1/1     146   538 ..     1   430 []  -200.3    0.025
gi|12744961|gb|AAK06860.1|              1/1     189   557 ..     1   430 []  -201.3    0.028
gi|8118130|gb|AAF72906.1|               1/1       1   157 []     1   430 []  -201.9     0.03
gi|6633842|gb|AAF19701.1|AC008047_8     1/1     153   555 ..     1   430 []  -202.0     0.03
gi|5817351|gb|AAD52719.1|AF123703_1     1/1       1   157 []     1   430 []  -202.3    0.032
gi|4680207|gb|AAD27570.1|AF114171_11    1/1     561   938 ..     1   430 []  -203.0    0.034
gi|5231014|gb|AAD41050.1|AF122982_1     1/1     165   587 ..     1   430 []  -203.0    0.034
gi|13487349|gb|AAK27506.1|              1/1     189   557 ..     1   430 []  -203.7    0.037
gi|7489351|pir||T30563                  1/1     152   484 ..     1   430 []  -204.0    0.038
gi|8118185|gb|AAF72928.1|               1/1       1   157 []     1   430 []  -204.3     0.04
gi|7489509|pir||T02226                  1/1       1   354 [.     1   430 []  -204.6    0.042
gi|11357253|pir||T48898                 1/1     160   589 ..     1   430 []  -204.9    0.043
gi|7489354|pir||T30564                  1/1     148   539 ..     1   430 []  -205.4    0.045
gi|9758140|dbj|BAB08632.1|              1/1     168   546 ..     1   430 []  -205.4    0.046
gi|6606266|gb|AAF19148.1|AF158634_1     1/1     172   599 ..     1   430 []  -205.6    0.046
gi|12744963|gb|AAK06861.1|              1/1     190   556 ..     1   430 []  -206.2     0.05
gi|1931650|gb|AAB65485.1|               1/1     135   498 ..     1   430 []  -206.4    0.051
gi|3075464|gb|AAC14553.1|               1/1       1   155 []     1   430 []  -207.7     0.06
gi|8118154|gb|AAF72916.1|               1/1       1   157 []     1   430 []  -208.6    0.067
gi|6983863|dbj|BAA90798.1|              1/1     157   546 ..     1   430 []  -209.0     0.07
gi|8118199|gb|AAF72933.1|               1/1       1   157 []     1   430 []  -209.2    0.072
gi|1361985|pir||A57072                  1/1     170   557 ..     1   430 []  -209.4    0.073
gi|8118136|gb|AAF72908.1|               1/1       1   157 []     1   430 []  -209.5    0.075
gi|10440622|gb|AAG16860.1|AC069145_9    1/1     172   524 ..     1   430 []  -209.7    0.076
gi|9758141|dbj|BAB08633.1|              1/1     172   483 ..     1   430 []  -209.9    0.078
gi|12321041|gb|AAG50637.1|AC082643_1    1/1     158   508 ..     1   430 []  -210.7    0.085
gi|8118188|gb|AAF72929.1|               1/1       1   157 []     1   430 []  -211.2    0.091
gi|5817339|gb|AAD52713.1|AF123697_1     1/1       3   158 .]     1   430 []  -211.5    0.094
gi|12325366|gb|AAG52625.1|AC024261_12   1/1     236   637 ..     1   430 []  -211.7    0.096
gi|11994217|dbj|BAB01339.1|             1/1     167   558 ..     1   430 []  -212.1      0.1
gi|10177352|dbj|BAB10695.1|             1/1     160   591 ..     1   430 []  -212.6     0.11
gi|6721550|dbj|BAA89580.1|              1/1     178   567 ..     1   430 []  -213.6     0.12
gi|7489350|pir||T30562                  1/1     148   515 ..     1   430 []  -213.9     0.13
gi|8118117|gb|AAF72900.1|               1/1       1   157 []     1   430 []  -214.3     0.13
gi|8118113|gb|AAF72898.1|               1/1       1   157 []     1   430 []  -215.8     0.16
gi|6721549|dbj|BAA89579.1|              1/1     170   554 ..     1   430 []  -215.9     0.16
gi|8118205|gb|AAF72936.1|               1/1       1   157 []     1   430 []  -216.0     0.16
gi|8118110|gb|AAF72897.1|               1/1       1   157 []     1   430 []  -216.0     0.16
gi|8118208|gb|AAF72937.1|               1/1       1   157 []     1   430 []  -216.0     0.16
gi|7489516|pir||T03031                  1/1      28   313 .]     1   430 []  -216.2     0.16
gi|9858468|gb|AAG01047.1|               1/1      23   172 ..     1   430 []  -216.6     0.17
gi|14475935|gb|AAK62782.1|AC027036_3    1/1     158   527 ..     1   430 []  -217.5     0.19
gi|6520173|dbj|BAA87943.1|              1/1     158   527 ..     1   430 []  -218.0      0.2
gi|14475950|gb|AAK62797.1|AC027036_18   1/1     158   527 ..     1   430 []  -218.0      0.2
gi|13310454|gb|AAK18296.1|AF338962_1    1/1       2   107 .]     1   430 []  -218.1     0.21
gi|8118201|gb|AAF72934.1|               1/1       1   157 []     1   430 []  -220.3     0.27
gi|7110565|gb|AAF36987.1|AF234174_1     1/1     161   552 ..     1   430 []  -220.7     0.28
gi|7489238|pir||T07770                  1/1       1   151 []     1   430 []  -220.8     0.29
gi|8118133|gb|AAF72907.1|               1/1       1   157 []     1   430 []  -222.1     0.33
gi|8118193|gb|AAF72931.1|               1/1       1   157 []     1   430 []  -224.0     0.42
gi|11357252|pir||T48899                 1/1     160   588 ..     1   430 []  -224.4     0.44
gi|13957628|gb|AAK50583.1|AC084404_8    1/1     180   575 ..     1   430 []  -224.4     0.44
gi|8118196|gb|AAF72932.1|               1/1       1   157 []     1   430 []  -225.8     0.52
gi|13093492|emb|CAC30706.1|             1/1     229   589 ..     1   430 []  -226.1     0.54
gi|7488088|pir||F71408                  1/1     130   463 ..     1   430 []  -226.7     0.58
gi|6649097|gb|AAF21368.1|AF146275_1     1/1       1   304 [.     1   430 []  -227.3     0.62
gi|7478889|pir||E70834                  1/1     197   573 ..     1   430 []  -229.4     0.79
gi|13879898|gb|AAK44621.1|              1/1     204   580 ..     1   430 []  -229.4     0.79
gi|7769860|gb|AAF69538.1|AC008007_13    1/1     471   902 ..     1   430 []  -230.4     0.89
gi|6721547|dbj|BAA89577.1|              1/1     194   561 ..     1   430 []  -230.8     0.94
gi|8118121|gb|AAF72902.1|               1/1       1   158 []     1   430 []  -231.3        1
gi|3411225|gb|AAC31552.1|               1/1      57   345 ..     1   430 []  -231.9      1.1
gi|9558523|dbj|BAB03441.1|              1/1     175   514 ..     1   430 []  -232.2      1.1
gi|14194911|sp|Q9PK50|LON_CHLMU         1/1     358   637 ..     1   430 []  -233.5      1.3
gi|3411227|gb|AAC31553.1|               1/1      82   345 ..     1   430 []  -233.8      1.3
gi|6225632|sp|O84348|LON_CHLTR          1/1     358   637 ..     1   430 []  -234.3      1.4
gi|5080812|gb|AAD39321.1|AC007258_10    1/1     155   568 ..     1   430 []  -234.3      1.4
gi|11691821|emb|CAC18690.1|             1/1     292   676 ..     1   430 []  -235.8      1.7
gi|7489393|pir||T04381                  1/1      90   348 ..     1   430 []  -236.9      1.9
gi|8778746|gb|AAF79754.1|AC009317_13    1/1     134   521 ..     1   430 []  -236.9      1.9
gi|8118166|gb|AAF72921.1|               1/1       1   158 []     1   430 []  -237.4        2
gi|7489400|pir||T04393                  1/1       1   265 [.     1   430 []  -237.4      2.1
gi|12642090|gb|AAK00132.1|AF207842_1    1/1     206   589 ..     1   430 []  -237.6      2.1
gi|7489401|pir||T04394                  1/1       1   269 []     1   430 []  -238.4      2.3
gi|5869874|emb|CAB55581.1|              1/1     126   457 ..     1   430 []  -239.1      2.5
gi|8118108|gb|AAF72896.1|               1/1       1   158 []     1   430 []  -239.5      2.6
gi|8118128|gb|AAF72905.1|               1/1       1   158 []     1   430 []  -239.6      2.7
gi|3982622|gb|AAC83563.1|               1/1       1   309 [.     1   430 []  -240.0      2.8
gi|5869886|emb|CAB55587.1|              1/1     126   457 ..     1   430 []  -240.8      3.1
gi|6857755|ref|NP_033814.1|             1/1     115   446 ..     1   430 []  -240.9      3.1
gi|8118123|gb|AAF72903.1|               1/1       1   158 []     1   430 []  -241.6      3.4
gi|4502123|ref|NP_001151.1|             1/1     115   446 ..     1   430 []  -242.0      3.5
gi|14764847|ref|XP_039639.1|            1/1     126   457 ..     1   430 []  -242.0      3.5
gi|7108333|ref|NP_037361.1|             1/1     115   446 ..     1   430 []  -242.0      3.5
gi|5869870|emb|CAB55579.1|              1/1     126   457 ..     1   430 []  -242.0      3.5
gi|5869872|emb|CAB55580.1|              1/1     126   457 ..     1   430 []  -242.0      3.5
gi|5869876|emb|CAB55582.1|              1/1     126   457 ..     1   430 []  -242.0      3.5
gi|5869880|emb|CAB55584.1|              1/1     126   457 ..     1   430 []  -242.0      3.5
gi|5869882|emb|CAB55585.1|              1/1     126   457 ..     1   430 []  -242.0      3.5
gi|5921467|emb|CAB56462.1|              1/1     126   457 ..     1   430 []  -242.0      3.5
gi|14764839|ref|XP_006885.4|            1/1     126   457 ..     1   430 []  -242.0      3.5
gi|14764851|ref|XP_039640.1|            1/1     126   457 ..     1   430 []  -242.0      3.5
gi|15023171|gb|AAK78307.1|AE007547_4    1/1      24   250 ..     1   430 []  -243.1        4
gi|13027436|ref|NP_076469.1|            1/1     126   457 ..     1   430 []  -243.1      4.1
gi|7489514|pir||T02236                  1/1      49   319 ..     1   430 []  -243.2      4.1
gi|5702198|gb|AAD47198.1|AF107294_1     1/1     189   486 ..     1   430 []  -243.6      4.3
gi|8118212|gb|AAF72939.1|               1/1       1   158 []     1   430 []  -243.7      4.3
gi|3982618|gb|AAC83561.1|               1/1       1   286 [.     1   430 []  -245.9      5.7
gi|4234955|gb|AAD13037.1|               1/1       1   292 [.     1   430 []  -245.9      5.7
gi|113491|sp|P25941|AFSR_STRCO          1/1     294   679 ..     1   430 []  -246.0      5.7
gi|7478876|pir||G70868                  1/1     242   618 ..     1   430 []  -246.1      5.8
gi|13882292|gb|AAK46866.1|              1/1     218   594 ..     1   430 []  -246.1      5.8
gi|8099241|gb|AAF72089.1|AC025098_23    1/1     187   596 ..     1   430 []  -246.5      6.1
gi|14028977|gb|AAK52518.1|AC079128_1    1/1     208   617 ..     1   430 []  -246.5      6.1
gi|7635936|emb|CAB88433.1|              1/1     294   679 ..     1   430 []  -246.5      6.1
gi|5821369|dbj|BAA83790.1|              1/1     294   666 ..     1   430 []  -246.6      6.1
gi|9858469|gb|AAG01048.1|               1/1       1   150 [.     1   430 []  -246.9      6.4
gi|4587240|dbj|BAA76678.1|              1/1       1   277 [.     1   430 []  -248.7      7.9
gi|5869878|emb|CAB55583.1|              1/1     126   457 ..     1   430 []  -249.3      8.5
gi|8118210|gb|AAF72938.1|               1/1       1   158 []     1   430 []  -249.4      8.5
gi|5869884|emb|CAB55586.1|              1/1     126   457 ..     1   430 []  -250.6      9.9

Alignments of top-scoring domains:
gi|6227009|gb|AAF06045.1|AC009513_1: domain 1 of 1, from 202 to 599: score 923.1, E = 9.3e-273
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      rDFd+l+G++aH++ m+ +LcL+s deVrM+GIwGP+GIGKTTIAR+
  gi|6227009   202    RDFDGLIGMRAHMKVMEPMLCLHS-DEVRMIGIWGPSGIGKTTIARI 247  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   Lfsq+S     +sF+ls+Fmen++++++        trp+++DeYs  +K
  gi|6227009   248 LFSQFS-----DSFELSVFMENVKELMY--------TRPVCSDEYS--AK 282  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   LhLQ+qf+S+I+n+kDi+I+ HLGv+e+RLkd+KV+I+LD +D++ QLdA
  gi|6227009   283 LHLQKQFMSQIINHKDIEIP-HLGVVEDRLKDKKVFIVLDNIDQSIQLDA 331  

                   LAketqWFGpGSRIIVTTeDkqLLkaHg.InhtIYeVgfPSkeeALqIFC
                   +Ake++WFG+GSRII+TT+D++LLkaH++Inh IY V fPS +eA+qIFC
  gi|6227009   332 IAKESRWFGHGSRIIITTQDRKLLKAHDgINH-IYNVNFPSAYEACQIFC 380  

                   rsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedm
                   ++AFgQ++P+dGFeeL A+eV+kL G LPLGLrV+GS++RG+sk+eW+++
  gi|6227009   381 MYAFGQKFPKDGFEEL-AWEVAKLLGGLPLGLRVMGSHFRGMSKHEWINA 429  

                   LpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyV
                   LpRLrt    +LD +I+++L++sY++L+e+D++LFL+IAC+FN + +++V
  gi|6227009   430 LPRLRT----RLDANIQSILKFSYNALCEEDKDLFLYIACLFNNKRIEKV 475  

                   kalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLG
                   +++La++ +L+V+qGL+vL++KSLI+i+         g+i+MHnLL+qLG
  gi|6227009   476 EEHLAEK-SLNVKQGLHVLTEKSLISIE--------GGRIKMHNLLEQLG 516  

                   ReAIVrk....QsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIs
                   +e IVr++ ++Q i  +ePgKRqFLvD+++Ic+ Lt++TG++  sV+GI+
  gi|6227009   517 KE-IVRHglghQPI--REPGKRQFLVDTRDICELLTNDTGSK--SVIGIH 561  

                   lDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   +  se++ elnIse+AFegM+NL+FLr+y ++ + + k   
  gi|6227009   562 FYSSELSSELNISERAFEGMPNLKFLRFYYRYGDESDK    599  

gi|9758812|dbj|BAB09346.1|: domain 1 of 1, from 20 to 421: score 920.6, E = 5.4e-272
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      rDFd+l+G++aH+++m+sLLcLds deVrM+GIwGP+GIGKTTIAR+
  gi|9758812    20    RDFDGLIGMDAHMKEMESLLCLDS-DEVRMIGIWGPSGIGKTTIARV 65   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L+sq+S     ++F+ls+Fm+n++++++        trp+++DeYs  +K
  gi|9758812    66 LYSQFS-----ENFELSIFMGNIKELMY--------TRPVCSDEYS--AK 100  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                    +LQ+qfLS+I+n+kD++ h HLGv+++RL+d+KVLI+LD +D++ QLdA
  gi|9758812   101 IQLQKQFLSQIINHKDMELH-HLGVAQDRLNDKKVLIVLDSIDQSIQLDA 149  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   +Aket+WFG+GSRII+TT+D++LLkaHgInh IY+V+fPS +eA q+FC+
  gi|9758812   150 IAKETRWFGHGSRIIITTQDQKLLKAHGINH-IYKVEFPSAYEAYQMFCM 198  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   +AFgQn+P dGFeeL A+eVtkL G+LPLGLrV+GS++RG+s +eW+++L
  gi|9758812   199 YAFGQNFPNDGFEEL-AWEVTKLLGHLPLGLRVMGSHFRGMSRHEWVNAL 247  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                   pRL+     +LD  I+++L++sYD+L+e+D++LFLhIAC+FN ++   V+
  gi|9758812   248 PRLKI----RLDASIQSILKFSYDALCEEDKDLFLHIACLFNNQEMVEVE 293  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                   ++La s +LDVrqG++ La+KSLI+ + l+++   + +ieMHnLL+qLG+
  gi|9758812   294 DYLALS-FLDVRQGFHLLAEKSLINLKFLSTN---CTRIEMHNLLVQLGK 339  

                   eAIVrk....QsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                   + IVr+++++Qsi  +ePgKRqFL+Da++Ic+VLtdnTG++  +V GI l
  gi|9758812   340 D-IVRHkpghQSI--CEPGKRQFLIDARDICEVLTDNTGNR--NVVGIFL 384  

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   ++++++++lnIse+AF+gM+NL+FLr+++ +++ + k   
  gi|9758812   385 EVRNLSCQLNISERAFDGMSNLKFLRFHDPYDDESDK    421  

gi|8953387|emb|CAB96660.1|: domain 1 of 1, from 231 to 621: score 903.8, E = 6.2e-267
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      rDFd+lVG++aHlekmk LLcLd  deVr++GIwGP+GIGKTTIAR+
  gi|8953387   231    RDFDGLVGMRAHLEKMKPLLCLDT-DEVRIIGIWGPPGIGKTTIARV 276  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++qLS     +sFqls+Fmen++ +y         trp g+D+Ys  +K
  gi|8953387   277 VYNQLS-----HSFQLSVFMENIKANY---------TRPTGSDDYS--AK 310  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   L+LQ++f+S+I++qkDi+I+ HLGv+++RLkd+KVL++LD+V++++QLdA
  gi|8953387   311 LQLQQMFMSQITKQKDIEIP-HLGVAQDRLKDKKVLVVLDGVNQSVQLDA 359  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   +Ake++WFGpGSRII+TT+D++L++aHgInh IY+V+fP +eeALqIFC+
  gi|8953387   360 MAKEAWWFGPGSRIIITTQDQKLFRAHGINH-IYKVDFPPTEEALQIFCM 408  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   +AFgQnsP+dGF++L A++V++LaGnLPLGLr++GS++RG+s eeW++ L
  gi|8953387   409 YAFGQNSPKDGFQNL-AWKVINLAGNLPLGLRIMGSYFRGMSREEWKKSL 457  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                   pRL++    sLD +I+++L++sYD+L+++D+ LFLhIACfFNg++++ ++
  gi|8953387   458 PRLES----SLDADIQSILKFSYDALDDEDKNLFLHIACFFNGKEIKILE 503  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                   ++La++ ++ Vrq+L+vLa+KSLI++s+       +gtieMH+LL +LG 
  gi|8953387   504 EHLAKK-FVEVRQRLNVLAEKSLISFSN-------WGTIEMHKLLAKLGG 545  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtse
                   e IVr+Qsi  +ePg+RqFL+D eeIcdVL+ +   + +sV+GI+++ + 
  gi|8953387   546 E-IVRNQSI--HEPGQRQFLFDGEEICDVLNGDAAGS-KSVIGIDFH-YI 590  

                   ieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   ieee++++e++FegM+NLqFLr++++   d+ +   
  gi|8953387   591 IEEEFDMNERVFEGMSNLQFLRFDCD--HDTLQ    621  

gi|7488217|pir||F71405: domain 1 of 1, from 139 to 524: score 902.7, E = 1.3e-266
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      rDFdd+VG+EaHle+mk LL+Ld+kd++++VGI+GPaGIGKTTIARA
  gi|7488217   139    RDFDDMVGLEAHLEEMKYLLDLDYKDGAMIVGICGPAGIGKTTIARA 185  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L+s+L      ssFqls+F+enl+        gS    + glDeY+  +K
  gi|7488217   186 LYSLLL-----SSFQLSCFVENLS--------GS---DNRGLDEYG--FK 217  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   L+LQeq+LSkILnq++++I  HLG+i+ERL+dqKVLI+LDDV+dl+QL+A
  gi|7488217   218 LRLQEQLLSKILNQNGMRIY-HLGAIQERLCDQKVLIVLDDVNDLKQLEA 266  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   LA+et+WFGpGSRIIVTTeDk LL++HgIn t Y+VgfPS eeAL+IFC 
  gi|7488217   267 LANETSWFGPGSRIIVTTEDKGLLEQHGINKT-YHVGFPSIEEALEIFCI 315  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   +AF+++sPpdGF++L +++Vt+  +nLPLGLrV+GSsLRGk ++eWe +L
  gi|7488217   316 YAFRKSSPPDGFKKL-TKRVTNVFDNLPLGLRVMGSSLRGKGEDEWEALL 364  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                    RL+t    sLD++Ie  Lrv+YD+L e++qaLFLhIA+fFN+ k+++V 
  gi|7488217   365 DRLET----SLDRNIEGALRVGYDSLQEEEQALFLHIAVFFNYNKDEHVI 410  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                   a+Lads nLDV+qGLk+L++KSL+  s+        g i+MH+LLqq+GR
  gi|7488217   411 AMLADS-NLDVKQGLKILTNKSLVYRST-------SGKIVMHKLLQQVGR 452  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtse
                   +A +++Q+     P+KR++L+Da+eIc+VL+++T+t+  + lGIslDts+
  gi|7488217   453 KA-IQRQE-----PWKRHILIDAHEICYVLENDTDTR--AALGISLDTSG 494  

                   ieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   i+ +++Ise AF++MrNL+FL++y++  r+ ++   
  gi|7488217   495 IN-KVIISEGAFKRMRNLRFLSVYNT--RYVKN    524  

gi|10178009|dbj|BAB11461.1|: domain 1 of 1, from 181 to 570: score 900.1, E = 8.3e-266
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      rDF+++VG+EaHl+k++sLLc++  d+V+M+GIwGPaGIGK+TIARA
  gi|1017800   181    RDFEGMVGLEAHLTKLNSLLCFEG-DDVKMIGIWGPAGIGKSTIARA 226  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L++qLS     ssFql++Fm+nl+        gS  ++++g+D Y   ++
  gi|1017800   227 LYNQLS-----SSFQLKCFMGNLK--------GS-LKSIVGVDHYE--FQ 260  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                    +LQ+ +L+kILnq D+++h +L +i+E+L+dq+VLIiLDDVDdleQL++
  gi|1017800   261 KSLQKLLLAKILNQGDMRVH-NLAAIKEWLQDQRVLIILDDVDDLEQLEV 309  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   LAke +WFG+GSRIIV TeDk++Lk HgIn+ IY+V+fPS eeAL+I+C+
  gi|1017800   310 LAKELSWFGSGSRIIVATEDKKILKEHGIND-IYHVDFPSMEEALEILCL 358  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   sAF+Q+s pdGFeeL A++V++L+GnLPLGL+++GSsLRG+sk+eWe +L
  gi|1017800   359 SAFKQSSVPDGFEEL-AKKVVHLCGNLPLGLSIVGSSLRGESKHEWELQL 407  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                   pR++     sLDgkIe++L+v+Y++L++k+q+LFLhIACfFN++ vdyV+
  gi|1017800   408 PRIEA----SLDGKIESILKVGYERLSKKNQSLFLHIACFFNYRSVDYVT 453  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMH.nLLqqLG
                    +Lads nLDVr+GLk+LadK+ +his        +g+i+MH++LLqqLG
  gi|1017800   454 VMLADS-NLDVRNGLKTLADKCFVHISI-------NGWIVMHhHLLQQLG 495  

                   ReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDts
                   R+ IV +Qs   dePgKRqFL++aeeI+ VLtd+TGtg  sV+GIs +ts
  gi|1017800   496 RQ-IVLEQS---DEPGKRQFLIEAEEIRAVLTDETGTG--SVIGISYNTS 539  

                   eieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   +i+ e+++s+ AFegMrNL+FLri++    ++gk   
  gi|1017800   540 NIG-EVSVSKGAFEGMRNLRFLRIFNY--LFSGK    570  

gi|10178243|dbj|BAB11675.1|: domain 1 of 1, from 179 to 574: score 893.8, E = 6.3e-264
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      +DF+++VGiE H++k++++LcL+ k +VrM GIwGP+GIGKTTIARA
  gi|1017824   179    NDFEGFVGIEGHIAKISLMLCLECK-QVRMFGIWGPSGIGKTTIARA 224  

                   LfsqLSerhFq.ssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGm
                   Lfs++S rhFq+s F ++aF+++++      ei+Sg     ++D+Y+  +
  gi|1017824   225 LFSRIS-RHFQgSVFLDRAFVSKSM------EIYSG----GNVDNYN--A 261  

                   KLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLd
                   KLhLQ +fLS+IL+ kDikI+ +LGv++ERLk++KVLI++DD+Dd+++Ld
  gi|1017824   262 KLHLQGKFLSEILRAKDIKIS-NLGVVGERLKHMKVLIFIDDLDDQVVLD 310  

                   ALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFC
                   ALA + +WFG+GSRIIV+T+Dkq+++aHgI + +YeVg+PS+++AL++F 
  gi|1017824   311 ALASKPHWFGCGSRIIVITKDKQFFRAHGIGL-FYEVGLPSDKLALEMFS 359  

                   rsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedm
                   +sAF+QnsPp GF eL A eV k+ GnLPL+L+VlGS+LRG++ke+W+dm
  gi|1017824   360 QSAFRQNSPPPGFTEL-ASEVSKRSGNLPLALNVLGSHLRGRDKEDWIDM 408  

                   LpRLrtsfgnsLDgkIekvLrvsYDgLhek.DqaLFLhIACfFNgekvdy
                   LpRLr+    +LDgkIek+Lrv+YD+L++k+D+a+F++IAC+FNg +++y
  gi|1017824   409 LPRLRK----GLDGKIEKILRVGYDELSNKdDKAIFRLIACLFNGAEISY 454  

                   VkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqL
                   +k lLads nL V++GLk+L+dKSLI+i         ++t+eMH++Lq++
  gi|1017824   455 IKLLLADS-NLGVTIGLKNLVDKSLIRIG--------CDTVEMHSMLQEM 495  

                   GReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDt
                   GRe IVr+Qsi  +ePg+R+FLvD+ +I dVL+dnTGt+  +VlGIs+D+
  gi|1017824   496 GRE-IVREQSI--YEPGEREFLVDSTDILDVLNDNTGTK--KVLGISFDM 540  

                   seieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   seie el+I+++AF++M+NL+FLr+ykk+ + +++   
  gi|1017824   541 SEIE-ELHIHKRAFKRMPNLRFLRFYKKLGKQSKE    574  

gi|8843884|dbj|BAA97410.1|: domain 1 of 1, from 181 to 570: score 892.6, E = 1.5e-263
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      rDF+++VG+EaHl++++sLLcL+s deV+M+GIwGPaGIGKTTIAR 
  gi|8843884   181    RDFEGMVGMEAHLKRLNSLLCLES-DEVKMIGIWGPAGIGKTTIART 226  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   Lf+++S     s F +++Fmenl+        gS    ++g  e++  +K
  gi|8843884   227 LFNKIS-----SIFPFKCFMENLK--------GS----IKGGAEHY--SK 257  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   L+LQ+q+LS+IL+q+++kIh HLG+i+++L+dqKVLIiLDDVDdleQL++
  gi|8843884   258 LSLQKQLLSEILKQENMKIH-HLGTIKQWLHDQKVLIILDDVDDLEQLEV 306  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   LA + +WFG+GSRIIVTTeDk +LkaH+I + IY+V+fPS+eeAL+I+C+
  gi|8843884   307 LAEDPSWFGSGSRIIVTTEDKNILKAHRIQD-IYHVDFPSEEEALEILCL 355  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   sAF+Q+s pdGFeeL A++V++L+GnLPLGL+V+G sLR+ksk+eWe++L
  gi|8843884   356 SAFKQSSIPDGFEEL-ANKVAELCGNLPLGLCVVGASLRRKSKNEWERLL 404  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                    R+++    sLD +I+++Lr++YD+L+ +Dq+LFLhIACfFN ekvdy++
  gi|8843884   405 SRIES----SLDKNIDNILRIGYDRLSTEDQSLFLHIACFFNNEKVDYLT 450  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMH.nLLqqLG
                   alLad  +LDV +G+++Lad+SL++is+       dg+++MH+ LLq+LG
  gi|8843884   451 ALLADR-KLDVVNGFNILADRSLVRIST-------DGHVVMHhYLLQKLG 492  

                   ReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDts
                   R  IV++Q+   +ePgKRqFL++aeeI+dVLt +TGt+  sV GIs+Dts
  gi|8843884   493 RR-IVHEQWP--NEPGKRQFLIEAEEIRDVLTKGTGTE--SVKGISFDTS 537  

                   eieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   +ie e+++ + AFegMrNLqFLriy++sf ++g    
  gi|8843884   538 NIE-EVSVGKGAFEGMRNLQFLRIYRDSFNSEGT    570  

gi|6598711|gb|AAD25848.2|AC007197_1: domain 1 of 1, from 225 to 612: score 891.0, E = 4.4e-263
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      rDFd+lVG++aH+ek+++LLcLds +eVrM+GIwGP+GIGKTTI R+
  gi|6598711   225    RDFDGLVGMGAHMEKLELLLCLDS-CEVRMIGIWGPPGIGKTTIVRF 270  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L++qLS     ssF+ls+Fmen+++++         t+ a++D+Ys  +K
  gi|6598711   271 LYNQLS-----SSFELSIFMENIKTMH---------TILASSDDYS--AK 304  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   L LQ+qfLSkIL++kDi+I+ HL v++ERL ++KVL++LDDVD+++QLdA
  gi|6598711   305 LILQRQFLSKILDHKDIEIP-HLRVLQERLYNKKVLVVLDDVDQSVQLDA 353  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   LAket+WFGp SRI +TT+D++LLkaH+In+ IY+V++P  ++ALqIFC+
  gi|6598711   354 LAKETRWFGPRSRILITTQDRKLLKAHRINN-IYKVDLPNSDDALQIFCM 402  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   +AFgQ++P+dGF++L Ar+Vt+L+Gn+PLGLrV+GS++R +sk+eW +++
  gi|6598711   403 YAFGQKTPYDGFYKL-ARKVTWLVGNFPLGLRVVGSYFREMSKQEWRKEI 451  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                   pRLr     +LDgkIe+vL++sYD+L+++D++LFLhIACfFN+e +++++
  gi|6598711   452 PRLRA----RLDGKIESVLKFSYDALCDEDKDLFLHIACFFNHESIEKLE 497  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                   ++L+++ +LD+ q+++vLa+KSLI+i+          ++eMH+ L qLG+
  gi|6598711   498 DFLGKT-FLDIAQRFHVLAEKSLISIN--------SNFVEMHDSLAQLGK 538  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtse
                   e IVrkQs+  +ePg+RqFLvDa++I++VL+d+T  g rsV+GI lD+++
  gi|6598711   539 E-IVRKQSV--REPGQRQFLVDARDISEVLADDTAGG-RSVIGIYLDLHR 584  

                   ieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   +++++nIsekAFegM+NLqFLr+++      g+   
  gi|6598711   585 NDDVFNISEKAFEGMSNLQFLRVKNF-----GN    612  

gi|9759538|dbj|BAB11004.1|: domain 1 of 1, from 183 to 568: score 889.5, E = 1.2e-262
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      +DF+d+VGiEaHl+km+sLL+Ld++d++++VGI+GPaGIGKTTIARA
  gi|9759538   183    WDFEDMVGIEAHLQKMQSLLHLDYEDGAMIVGIYGPAGIGKTTIARA 229  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L+s+LS     ssFql++Fmen+r        gS   +++glDeY+  +K
  gi|9759538   230 LHSRLS-----SSFQLTCFMENIR--------GS---YNSGLDEYG--LK 261  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   L+LQeq+LSk+Ln+++i+I+ HLG+i+ERL+dqKVLIiLDDVDdl+QL+A
  gi|9759538   262 LRLQEQLLSKVLNHDGIRIN-HLGAIPERLCDQKVLIILDDVDDLQQLEA 310  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   LA+et+WFGpGSRIIVTTeD++LL++H++n + Y+V+fP++eeA++IFC 
  gi|9759538   311 LANETNWFGPGSRIIVTTEDQELLEQHDVNKK-YHVDFPTREEACKIFCT 359  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   +AF+++++p+GFe+L A++Vt+L+ nLPLGLrV+GS LRGk++++We +L
  gi|9759538   360 YAFRRSFAPYGFEKL-AERVTWLCSNLPLGLRVMGSTLRGKKEDDWEGIL 408  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                   +RL++    sLD+kI+ vLrv+YD L+e Dq L+L+IA+fFN+ ++d+Vk
  gi|9759538   409 RRLEN----SLDRKIDGVLRVGYDHLCEDDQFLYLLIAFFFNYVDDDHVK 454  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                   a+L ++ nLDV++GLk+La+KSLI+is        +g i+MH+LLq +GR
  gi|9759538   455 AMLVED-NLDVKLGLKTLAYKSLIQISA-------EGNIVMHKLLQRVGR 496  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtse
                   eA +++Q+     P KR++L+Da+eIcdVL +++Gt+  +V+GIs+Dts 
  gi|9759538   497 EA-IQRQE-----PTKRRILIDAREICDVLRYGKGTS--NVSGISFDTSD 538  

                   ieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   ++ e+ Is++AF+++++L+FL++ k+  r+dgk   
  gi|9759538   539 MS-EVTISDDAFKRLHDLRFLKVTKS--RYDGK    568  

gi|8843883|dbj|BAA97409.1|: domain 1 of 1, from 138 to 526: score 886.3, E = 1.2e-261
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      rDF+++VG+EaHl++++sLLcL+s deV+M+GIwGPaGIGKTTIARA
  gi|8843883   138    RDFEGMVGMEAHLKRLNSLLCLES-DEVKMIGIWGPAGIGKTTIARA 183  

                   Lfs.qLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGm
                   Lf+++LS     ssFq+++Fm+nl+        gS    ++g+ +++  +
  gi|8843883   184 LFDdRLS-----SSFQHKCFMGNLK--------GS----IKGVADHD--S 214  

                   KLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLd
                   KL+LQ+q+LSkI++ +++kIh HLG+i+ERL+dq+VLIiLDDVDdl+QL+
  gi|8843883   215 KLRLQKQLLSKIFKEENMKIH-HLGAIRERLHDQRVLIILDDVDDLKQLE 263  

                   ALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFC
                   +LAke++WFG+GSRII TTeDk++LkaHgI + IY V+fPSk++AL+I+C
  gi|8843883   264 VLAKEISWFGSGSRIIGTTEDKKILKAHGIHN-IYRVDFPSKKDALEILC 312  

                   rsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedm
                   +sAF+Q+s pdGFeeL A++V+kL+ nLPLGL+V+G sLRG+  +eWe++
  gi|8843883   313 LSAFKQSSIPDGFEEL-ANKVAKLCSNLPLGLCVVGASLRGEGNQEWERL 361  

                   LpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyV
                   L R+++    sLD++I+++Lr++YD+L  +D++LFLhIACfFN+ kvd+V
  gi|8843883   362 LSRIES----SLDRDIDDILRIGYDRLLTNDKSLFLHIACFFNYAKVDNV 407  

                   kalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLG
                   +alLads nLDV +G+++Lad+SLI++s+        g+ieMH+LLqqLG
  gi|8843883   408 TALLADS-NLDVGNGFNTLADRSLINFSCILP----YGRIEMHHLLQQLG 452  

                   ReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDts
                   R+ IV +Qs+   ePgKR+F +++eeI+dVLt++TGtg  sV+GIs+Dts
  gi|8843883   453 RQ-IVLEQSK---EPGKREFIIEPEEIRDVLTNETGTG--SVIGISFDTS 496  

                   eieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   +i+ e+++s++AFegMrNL+FLriy+      g+   
  gi|8843883   497 NIG-EVSVSKDAFEGMRNLRFLRIYR---LLGGE    526  

gi|12324940|gb|AAG52419.1|AC011622_7: domain 1 of 1, from 181 to 567: score 884.8, E = 3.2e-261
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      +DF+d+VGiEaHl+km+sLL+Ld++de+++VGI+GP+GIGKTTIARA
  gi|1232494   181    KDFEDMVGIEAHLQKMQSLLHLDNEDEAMIVGICGPSGIGKTTIARA 227  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L+s+LS     ssFql++Fmenl+        gS   +++glDeY+  +K
  gi|1232494   228 LHSRLS-----SSFQLTCFMENLK--------GS---YNSGLDEYG--LK 259  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   L+LQ+q+LSkILnq+D++I  HLG+i+ERL+dq VLIiLD+VDdl+QL+A
  gi|1232494   260 LCLQQQLLSKILNQNDLRIF-HLGAIPERLCDQNVLIILDGVDDLQQLEA 308  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   L +et+WFGpGSRIIVTTeD++LL++H+In+t Y+V+fP+ +eA +IFCr
  gi|1232494   309 LTNETSWFGPGSRIIVTTEDQELLEQHDINNT-YHVDFPTIKEARKIFCR 357  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   sAF+Q+s+p+GFe+L +++V kL+ nLPLGLrV+GSsLR+k++++We +L
  gi|1232494   358 SAFRQSSAPYGFEKL-VERVLKLCSNLPLGLRVMGSSLRRKKEDDWESIL 406  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                   +R ++    sLD+kIe vLrv+YD Lh++Dq LFL+IA+fFN+++ d+Vk
  gi|1232494   407 HRQEN----SLDRKIEGVLRVGYDNLHKNDQFLFLLIAFFFNYQDNDHVK 452  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                   a+L+ds +LDVr+GLk+La+KSLI+is        +g i+MH+LLqq+G+
  gi|1232494   453 AMLGDS-KLDVRYGLKTLAYKSLIQISI-------KGDIVMHKLLQQVGK 494  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtse
                   eA V++Q       gKRq+L+D+ eIcdVL++++G++  +V+GIs+D+s 
  gi|1232494   495 EA-VQRQD-----HGKRQILIDSDEICDVLENDSGNR--NVMGISFDIST 536  

                   ieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   + + ++Is +AF+++rNL+FL+iyk+  r d++   
  gi|1232494   537 LLNDVYISAEAFKRIRNLRFLSIYKT--RLDTN    567  

gi|9757889|dbj|BAB08396.1|: domain 1 of 1, from 185 to 579: score 881.8, E = 2.6e-260
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                       DF+dl G+EaH +++ks+L L+s +eV+M+G+wGPaGIGKTTI R+
  gi|9757889   185    TDFEDLLGLEAHVANLKSMLGLES-NEVKMIGVWGPAGIGKTTITRI 230  

                   LfsqLSerhFq.ssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGm
                   L++qLS  + ++++Fql +Fmen++gsy          r +++D Ys  m
  gi|9757889   231 LYNQLS--SSNdDDFQLFIFMENVKGSY----------RRKEIDGYS--M 266  

                   KLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLd
                   KLhL+e+fLS+I+ q  ik++ HLGv++ERLk+qK LI+LDDVD leQL 
  gi|9757889   267 KLHLRERFLSEITTQRKIKVS-HLGVAQERLKNQKALIVLDDVDELEQLR 315  

                   ALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFC
                   ALA++tqW G+G RI VTTeD+qLLkaHgI h +YeV++PS++eAL+I+C
  gi|9757889   316 ALADQTQWVGNGTRILVTTEDRQLLKAHGITH-VYEVDYPSRDEALKILC 364  

                   rsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedm
                   ++AFg+ns+p+G+++L A+eV++LaG+LPLGL+VlG sLRG+sk+eW+++
  gi|9757889   365 QCAFGKNSAPEGYNDL-AVEVVELAGYLPLGLSVLGASLRGMSKKEWINA 413  

                   LpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyV
                   LpRLrt    sL+gkIek Lrv+Y+gL+ekD+a+FLhIAC+FNg++vd+V
  gi|9757889   414 LPRLRT----SLNGKIEKLLRVCYEGLDEKDKAIFLHIACLFNGKNVDRV 459  

                   kalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLG
                   k lLa+s  LDV++GLkvL+d+SLIhi+        dg+i+MH+LLqqLG
  gi|9757889   460 KLLLAKS-ALDVEFGLKVLVDRSLIHIDA-------DGYIVMHCLLQQLG 501  

                   ReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDts
                   +e I r Q+ d  ePgKR+FLvD+ eI+dVL+d+TGt+  +VlGIslD+s
  gi|9757889   502 KE-ITRGQCLD--EPGKRKFLVDSLEISDVLADETGTE--TVLGISLDMS 546  

                   eieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   eie+++++sekAFe+M+NLqFL+ yk+ f d+     
  gi|9757889   547 EIEDQVYVSEKAFEKMPNLQFLWLYKN-FPDEAV    579  

gi|7486351|pir||T01916: domain 1 of 1, from 179 to 571: score 881.8, E = 2.6e-260
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      rDF+dlVG+EaH++km+sLLcL+s ++Vr+VGIwGPaG+GKTTIARA
  gi|7486351   179    RDFNDLVGMEAHIAKMESLLCLES-QGVRIVGIWGPAGVGKTTIARA 224  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L++q +     ++F ls+Fmen+r+sy           +aglD+Y+  +K
  gi|7486351   225 LYNQYH-----ENFNLSIFMENVRESY----------GEAGLDDYG--LK 257  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   LhLQ++fLSk+L+qkD++++ HLG+ieERLk qKVLIiLDDVD++eQL+A
  gi|7486351   258 LHLQQRFLSKLLDQKDLRVR-HLGAIEERLKSQKVLIILDDVDNIEQLKA 306  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   LAke qWFG+ SRI+VTT++kqLL +H+Inh +Y+V +PSk+eAL+IFC+
  gi|7486351   307 LAKENQWFGNKSRIVVTTQNKQLLVSHDINH-MYQVAYPSKQEALTIFCQ 355  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   +AF+Q+sP d+ ++L A e+t+LaG+LPL+LrVlGS +RGk keeWe  L
  gi|7486351   356 HAFKQSSPSDDLKHL-AIEFTTLAGHLPLALRVLGSFMRGKGKEEWEFSL 404  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                   p L++    +LDg++ekvL+v+YDgLh+++++LFLhIAC+F g++ +y+k
  gi|7486351   405 PTLKS----RLDGEVEKVLKVGYDGLHDHEKDLFLHIACIFSGQHENYLK 450  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                   +++ ++n+  V++GL+vLadKSLI+  +       +g+ieMH+LL+qLG+
  gi|7486351   451 QMIIANNDTYVSFGLQVLADKSLIQKFE-------NGRIEMHSLLRQLGK 493  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtse
                   e +VrkQsi  +ePgKRqFL++a+e c VL++nTGtg  +VlGIslD++e
  gi|7486351   494 E-VVRKQSI--YEPGKRQFLMNAKETCGVLSNNTGTG--TVLGISLDMCE 538  

                   ieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   i+eel+Isek Fe MrNL +L++y++s +dd++   
  gi|7486351   539 IKEELYISEKTFEEMRNLVYLKFYMSSPIDDKM    571  

gi|7487334|pir||T08196: domain 1 of 1, from 179 to 571: score 881.8, E = 2.6e-260
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      rDF+dlVG+EaH++km+sLLcL+s ++Vr+VGIwGPaG+GKTTIARA
  gi|7487334   179    RDFNDLVGMEAHIAKMESLLCLES-QGVRIVGIWGPAGVGKTTIARA 224  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L++q +     ++F ls+Fmen+r+sy           +aglD+Y+  +K
  gi|7487334   225 LYNQYH-----ENFNLSIFMENVRESY----------GEAGLDDYG--LK 257  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   LhLQ++fLSk+L+qkD++++ HLG+ieERLk qKVLIiLDDVD++eQL+A
  gi|7487334   258 LHLQQRFLSKLLDQKDLRVR-HLGAIEERLKSQKVLIILDDVDNIEQLKA 306  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   LAke qWFG+ SRI+VTT++kqLL +H+Inh +Y+V +PSk+eAL+IFC+
  gi|7487334   307 LAKENQWFGNKSRIVVTTQNKQLLVSHDINH-MYQVAYPSKQEALTIFCQ 355  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   +AF+Q+sP d+ ++L A e+t+LaG+LPL+LrVlGS +RGk keeWe  L
  gi|7487334   356 HAFKQSSPSDDLKHL-AIEFTTLAGHLPLALRVLGSFMRGKGKEEWEFSL 404  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                   p L++    +LDg++ekvL+v+YDgLh+++++LFLhIAC+F g++ +y+k
  gi|7487334   405 PTLKS----RLDGEVEKVLKVGYDGLHDHEKDLFLHIACIFSGQHENYLK 450  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                   +++ ++n+  V++GL+vLadKSLI+  +       +g+ieMH+LL+qLG+
  gi|7487334   451 QMIIANNDTYVSFGLQVLADKSLIQKFE-------NGRIEMHSLLRQLGK 493  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtse
                   e +VrkQsi  +ePgKRqFL++a+e c VL++nTGtg  +VlGIslD++e
  gi|7487334   494 E-VVRKQSI--YEPGKRQFLMNAKETCGVLSNNTGTG--TVLGISLDMCE 538  

                   ieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   i+eel+Isek Fe MrNL +L++y++s +dd++   
  gi|7487334   539 IKEELYISEKTFEEMRNLVYLKFYMSSPIDDKM    571  

gi|3757516|gb|AAC64218.1|: domain 1 of 1, from 180 to 565: score 881.5, E = 3.2e-260
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                       DFd++VGiEaHl++m+ LL++d+ d+V++VGI GPaGIGKTTIARA
  gi|3757516   180    SDFDGMVGIEAHLKEMEVLLDFDY-DGVKIVGIFGPAGIGKTTIARA 225  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L+s+L +    ++Fql++F++nlr        gS   +p+g+DeY+  +K
  gi|3757516   226 LHSLLLF----KKFQLTCFVDNLR--------GS---YPIGIDEYG--LK 258  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   L+LQe++LSkILnq++++I+ HLG+++ERL+d+KVLIiLDDV+d++QL+A
  gi|3757516   259 LRLQEHLLSKILNQDGMRIS-HLGAVKERLCDMKVLIILDDVNDVKQLEA 307  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   LA++t+WFGpGSR+IVTTe+k++L+ HgI++ +Y+VgfPS+e A++I+C 
  gi|3757516   308 LANDTTWFGPGSRVIVTTENKEILQRHGIDN-MYHVGFPSDEKAMEILCG 356  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   +AF+Q+sP+ GF+ L A++Vt+L+GnLPLGLrV+GSsLRGk+++eW+ ++
  gi|3757516   357 YAFKQSSPRPGFNYL-AQKVTWLCGNLPLGLRVVGSSLRGKKEDEWKSVI 405  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                   +RL t     +D++Ie+vLrv+Y++Lhe++q+LFLhIA+fFN+++vd+Vk
  gi|3757516   406 RRLDT----IIDRDIEDVLRVGYESLHENEQSLFLHIAVFFNCKDVDLVK 451  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                   a+Lad+ nLD+ +GLk+L++KSLI is++g+       i+MH+LLqq+GR
  gi|3757516   452 AMLADD-NLDIAHGLKILVNKSLIYISTTGE-------IRMHKLLQQVGR 493  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtse
                   +A + +Q+     P+KR +L++a+eIc+VL++++Gtg   V+GIs+Dts+
  gi|3757516   494 QA-INRQE-----PWKRLILTNAQEICYVLENDKGTG--VVSGISFDTSG 535  

                   ieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   i+ e++ s +A+++M+NL+FL++yk+  r+dg+   
  gi|3757516   536 IS-EVILSNRALRRMSNLRFLSVYKT--RHDGN    565  

gi|9758866|dbj|BAB09448.1|: domain 1 of 1, from 226 to 623: score 881.0, E = 4.7e-260
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      rDFddl+G+EaH+ekmksLL L+s +eV+M+GIwGP+GIGKTTIAR+
  gi|9758866   226    RDFDDLIGMEAHMEKMKSLLSLHS-NEVKMIGIWGPSGIGKTTIARV 271  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L++++S      +F ls+Fm+n++++++        trp+g+D+Ys  +K
  gi|9758866   272 LYNRFS-----GDFGLSVFMDNIKELMH--------TRPVGSDDYS--AK 306  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   LhLQ+q++S+I+n+k  kI  HLGv+++RLkd KVLI+LD +D++ QLdA
  gi|9758866   307 LHLQNQLMSEITNHKETKIT-HLGVVPDRLKDNKVLIVLDSIDQSIQLDA 355  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   +AketqWFGpGSRII+TT+D++LL+aH+In+ IY+V+fPSk+eA+qIFC 
  gi|9758866   356 IAKETQWFGPGSRIIITTQDQKLLEAHDINN-IYKVEFPSKYEAFQIFCT 404  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   +AFgQn+P+dGFe+L A+eVt L G+LPLGLrV+GS++R++sk++W+ +L
  gi|9758866   405 YAFGQNFPKDGFEKL-AWEVTDLLGELPLGLRVMGSHFRRMSKDDWVIAL 453  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                   pRL+t    +LD +I+++L++sYD+L+ +D++LFLhIAC+FN e++ +V+
  gi|9758866   454 PRLKT----RLDANIQSILKFSYDALSPEDKDLFLHIACLFNNEEIVKVE 499  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                   ++La + +LD r+GL+ La+KSLI  +  +      +  +MHnLL+qLG+
  gi|9758866   500 DYLALD-FLDARHGLHLLAEKSLIDLEGVN-----YKVLKMHNLLEQLGK 543  

                   eAIVrk....QsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                   e IVr ++ ++si  +eP+KRqFLvD+++Ic+VL+d+TG++  s+ GI +
  gi|9758866   544 E-IVRYhpahHSI--REPEKRQFLVDTKDICEVLADGTGSK--SIKGICF 588  

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   D+++++  lnIse+AFegM+NL+FLr+ ++  r+++    
  gi|9758866   589 DLDNLSGRLNISERAFEGMTNLKFLRVLRD--RSEKL    623  

gi|10177970|dbj|BAB11353.1|: domain 1 of 1, from 180 to 559: score 880.3, E = 7.5e-260
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      rDF+++VG+EaHl+k++s LcL+s d+V+M+GIwGPaGIGKTTIARA
  gi|1017797   180    RDFEGMVGLEAHLTKLDSFLCLES-DDVKMIGIWGPAGIGKTTIARA 225  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   Lf+qLS       F+ls+Fm+   +              + +++Y+  +K
  gi|1017797   226 LFNQLS-----TGFRLSCFMG---T--------------IDVNDYD--SK 251  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   L+LQ+++LSkILnqkD+kIh HLG+ieE+L++q+VLI+LDDVDdleQL++
  gi|1017797   252 LCLQNKLLSKILNQKDMKIH-HLGAIEEWLHNQRVLIVLDDVDDLEQLEV 300  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   LAke++WFG+GSRIIV  +D+++LkaHgIn+ IY V+fPS+eeAL+I+C+
  gi|1017797   301 LAKESSWFGHGSRIIVSLNDRKILKAHGIND-IYDVDFPSEEEALEILCL 349  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   sAF+QnsP+dGFee  A++V++L+G+LPLGLrV+GSs+ G+s++eW  +L
  gi|1017797   350 SAFKQNSPQDGFEEV-AKRVVELCGKLPLGLRVVGSSFYGESEDEWRIQL 398  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                     ++t     LD+kIe+vLrv+YD+L+e++q+LFLhIACfFN++ vdyV+
  gi|1017797   399 YGIET----NLDRKIENVLRVGYDKLSERHQSLFLHIACFFNHKSVDYVT 444  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                   ++Lads  LDV++GLk+La KSL++ +         g+i MH+LLqqLGR
  gi|1017797   445 TMLADS-TLDVENGLKTLAAKSLVSTN---------GWITMHCLLQQLGR 484  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtse
                   + +V +Q     +PgKRqFLv+a+eI+dVL+++TGt+  sV+GIs+D+s+
  gi|1017797   485 Q-VVVQQG----DPGKRQFLVEAKEIRDVLANETGTE--SVIGISFDISK 527  

                   ieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   ie +l+Is++AF +MrNL+FL++y+ s +  +    
  gi|1017797   528 IE-TLSISKRAFNRMRNLKFLNFYNGSVSLLED    559  

gi|6721163|gb|AAF26791.1|AC016829_15: domain 1 of 1, from 232 to 623: score 877.3, E = 6e-259
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      rDFddl+G+++H+ekmk LL+ ds de++ +GIwGP+G+GKTTIAR 
  gi|6721163   232    RDFDDLIGMGDHMEKMKPLLDIDS-DEMKTIGIWGPPGVGKTTIARS 277  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L++q+S     ++Fqls+Fme +++ y         t+pa++D+Y+   K
  gi|6721163   278 LYNQHS-----DKFQLSVFMESIKTAY---------TIPACSDDYY--EK 311  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   L+LQ++fLS+I+nq++++I+ HLGv++ERL+d+KVL+++DDV++++Q dA
  gi|6721163   312 LQLQQRFLSQITNQENVQIP-HLGVAQERLNDKKVLVVIDDVNQSVQVDA 360  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   LAke  W GpGSRII+TT+D+ +L+aHgI+h IYeV++P  eeALqIFC+
  gi|6721163   361 LAKENDWLGPGSRIIITTQDRGILRAHGIEH-IYEVDYPNYEEALQIFCM 409  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   +AFgQ+sP+dGFeeL A++Vt+L G LPLGL+V+GS++RG++k+eW  +L
  gi|6721163   410 HAFGQKSPYDGFEEL-AQQVTTLSGRLPLGLKVMGSYFRGMTKQEWTMAL 458  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                   pR rt    +LDgkIe++L+ sYD+L++ D++LFLh AC F+  + ++V+
  gi|6721163   459 PRVRT----HLDGKIESILKLSYDALCDVDKSLFLHLACSFHNDDTELVE 504  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                   ++L+++ + D rqGL+vLa+KSLIh++         + i+MH LL qLGR
  gi|6721163   505 QQLGKK-FSDLRQGLHVLAEKSLIHMD--------LRLIRMHVLLAQLGR 545  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtse
                   e IVrkQsi  +ePg+RqFLvDa +I++VLtd+TG++  sV+GI++D + 
  gi|6721163   546 E-IVRKQSI--HEPGQRQFLVDATDIREVLTDDTGSR--SVIGIDFDFNT 590  

                   ieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   +e+el+IsekAF+gM+NLqF riy ++f+++g    
  gi|6721163   591 MEKELDISEKAFRGMSNLQFIRIYGDLFSRHGV    623  

gi|12325006|gb|AAG52448.1|AC010852_5: domain 1 of 1, from 182 to 571: score 877.0, E = 7.4e-259
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      rDFd++VGiEaHl+++ksLL+Ld+  eV++V I GPaGIGKTTIARA
  gi|1232500   182    RDFDGMVGIEAHLREIKSLLDLDN-VEVKIVAIAGPAGIGKTTIARA 227  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L+ +LS     ++Fqls+F++nlrgsy+           +g+DeY+  +K
  gi|1232500   228 LYGLLS-----KRFQLSCFVDNLRGSYH-----------SGFDEYG--FK 259  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   LhLQeqfLSk+Lnq +++I+ HLG+i+E L dq+VLIiLDDV++l+QL+A
  gi|1232500   260 LHLQEQFLSKVLNQSGMRIC-HLGAIKENLSDQRVLIILDDVNKLKQLEA 308  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   LA+et+WFGpGSRI+VTTe+k+LL++HgIn+t Y+VgfPS+e+AL+I+C 
  gi|1232500   309 LANETTWFGPGSRIVVTTENKELLQQHGINNT-YHVGFPSDEDALKILCS 357  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   +AF+Q+sP++GFeeL ++ VtkL+G+LPLGL+V+GSsLRGk+++eWed+ 
  gi|1232500   358 YAFKQTSPRHGFEEL-SESVTKLCGKLPLGLCVVGSSLRGKKEDEWEDVV 406  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                    RL+t     LD++Ie+vLrv+Y++L+e+ q LFLhIA+fFN+e+ d+Vk
  gi|1232500   407 TRLET----ILDQDIEDVLRVGYESLDENAQTLFLHIAIFFNKEDGDLVK 452  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                   ++ a+s +LDV++GLk+L ++SLI+++  +n    d  i+MH+LLqq+G+
  gi|1232500   453 TMFAES-DLDVKYGLKILENRSLIKMKIFSNG---DTKIVMHRLLQQMGK 498  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtse
                    A ++kQ+     P++Rq+L+Da+eIc VL++++Gtg+ +V G+s+D+s+
  gi|1232500   499 RA-IQKQE-----PWERQILIDAREICHVLEHAKGTGW-NVHGMSFDISR 541  

                   ieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   i+ e++I +kAF++M+NLqFL++yk+  +ddg+   
  gi|1232500   542 IS-EVSIRKKAFKRMPNLQFLKVYKS--KDDGN    571  

gi|6692110|gb|AAF24575.1|AC007764_17: domain 1 of 1, from 380 to 764: score 875.3, E = 2.3e-258
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      rDFd++VGiEaHl+k++sLL+Ld+ deV+MV I+GPaGIGK+TI+RA
  gi|6692110   380    RDFDGMVGIEAHLRKIQSLLDLDN-DEVKMVAISGPAGIGKSTIGRA 425  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L+s+LS     ++F++++F++nlr        gS   +p+glDeY+  +K
  gi|6692110   426 LHSLLS-----NRFHHTCFVDNLR--------GS---HPIGLDEYG--LK 457  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   L+LQeq+LSkILnq++ +I+ HLG+i+ERL+d+KV+IiLDDV+d++QL+A
  gi|6692110   458 LRLQEQLLSKILNQDGSRIC-HLGAIKERLCDMKVFIILDDVNDVKQLEA 506  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   LA+e++WFGpGSRIIVTTe+k+LLk+HgIn+t Y VgfPS+eeA +I+Cr
  gi|6692110   507 LANESNWFGPGSRIIVTTENKELLKQHGINNT-YYVGFPSDEEAIKILCR 555  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   +AF+Q+s ++GF++L +r Vt+L+G+LPLGLrV+GSsL+Gk++eeWe ++
  gi|6692110   556 YAFRQSSSRHGFKKL-TRSVTELCGKLPLGLRVVGSSLHGKNEEEWEYVI 604  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                   +RL+t     +D++Ie vLrv+Y++Lhe++q+LFLhIA+fFN+e+ d+Vk
  gi|6692110   605 RRLET----IIDRDIEQVLRVGYESLHENEQSLFLHIAIFFNYEDGDLVK 650  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                   a+La++ +LD+++ L++L++KSLI is+       dg+i+MH+LLq +GR
  gi|6692110   651 AMLAEN-DLDIEHELNILVNKSLIYIST-------DGRIRMHKLLQLVGR 692  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtse
                   +A   +Q    +eP+KR++L+Da+eIc VL++++Gtg  +V+GI +Dts+
  gi|6692110   693 QA---NQR---EEPWKRRILIDAQEICHVLENDIGTG--AVSGILFDTSG 734  

                   ieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   i+ e++Is kA+++M+NL+FL++yk+  ++dg+   
  gi|6692110   735 IN-EVSISNKALRRMCNLRFLSVYKT--KHDGY    764  

gi|10177582|dbj|BAB10813.1|: domain 1 of 1, from 181 to 572: score 871.2, E = 4e-257
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      +DF+++VGi++H+ek ++LL+L+s deVrMVGIwG +GIGKTTIARA
  gi|1017758   181    NDFEEFVGIKDHIEKVRLLLHLES-DEVRMVGIWGTSGIGKTTIARA 226  

                   LfsqLSerhFq.ssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGm
                   Lfs LS ++Fq+s ++++aF+++++      e +++    a++D+Y+  m
  gi|1017758   227 LFSNLS-SQFQsSVYIDRAFISKSM------EGYGR----ANPDDYN--M 263  

                   KLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLd
                   KL+L+e+fL +IL++k++kI     ++eERLk+qKVLIi+DD+Dd+++Ld
  gi|1017758   264 KLRLRENFLFEILGKKNMKIG----AMEERLKHQKVLIIIDDLDDQDVLD 309  

                   ALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFC
                   AL++ tqWFG+GSRIIV+T++k++L+aHgI+h +Ye ++PS+e+AL++FC
  gi|1017758   310 ALVGRTQWFGSGSRIIVVTKNKHFLRAHGIDH-VYEACLPSEELALEMFC 358  

                   rsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedm
                   r+AF++nsPpdGF+eL + eV+ +aGnLPLGL+VlGS+LRG++ e+W+dm
  gi|1017758   359 RYAFRKNSPPDGFMEL-SSEVALRAGNLPLGLKVLGSYLRGRDIEDWMDM 407  

                   LpRLrtsfgnsLDgkIekvLrvsYDgLhek.DqaLFLhIACfFNgekvdy
                   +pRL++     LDgkIek+LrvsYDgL++k+D a+F+hIAC+FNgekv++
  gi|1017758   408 MPRLQN----DLDGKIEKTLRVSYDGLNNKkDEAIFRHIACLFNGEKVND 453  

                   VkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqL
                   +k lLa+s +LDV++GLk+L+dKSLI ++        ++tieMH+LLq +
  gi|1017758   454 IKLLLAES-DLDVNIGLKNLVDKSLIFVR--------EDTIEMHRLLQDM 494  

                   GReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDt
                   G+e IVr+Qs+   ePg+R+FLvD++ I+dVL+dnTGt+  +VlGI lD+
  gi|1017758   495 GKE-IVRAQSN---EPGEREFLVDSKHIYDVLEDNTGTK--KVLGIALDI 538  

                   seieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   +e++  l+I+e+AF+gMrNL+FL++y+k ++d +    
  gi|1017758   539 NETD-GLYIHESAFKGMRNLLFLNFYTKQKKDVTW    572  

gi|7485310|pir||T14515: domain 1 of 1, from 176 to 573: score 864.7, E = 3.8e-255
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      +DFd++ GiE+H++++++LLcL+s +eVrMVGIwGP GIGKTTIARA
  gi|7485310   176    KDFDEFFGIEDHIKELSLLLCLES-EEVRMVGIWGPTGIGKTTIARA 221  

                   LfsqLSerhFq.ssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGm
                   Lf++++ rhFq++ F+++aF+++++      +i+S+    a++D+Y+  +
  gi|7485310   222 LFNRIY-RHFQgRVFIDRAFISKSM------AIYSR----ANSDDYN--L 258  

                   KLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLd
                   KLhLQe++LSk+L++k+++I+ HL +++ERL+++KVLI++DD+Dd+++L+
  gi|7485310   259 KLHLQEKLLSKLLDKKNLEIN-HLDAVKERLRQMKVLIFIDDLDDQVVLE 307  

                   ALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFC
                   ALA +tqWFG+GSRIIV+T+Dk+LL+a+gI+h IYeV +PSk++A ++FC
  gi|7485310   308 ALACQTQWFGHGSRIIVITKDKHLLRAYGIDH-IYEVLLPSKDLAIKMFC 356  

                   rsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedm
                   rsAF+++sPp+GF eL A+ V+k+aG+LPLGL++lGS+LRG+ske+W+dm
  gi|7485310   357 RSAFRKDSPPNGFIEL-AYDVVKRAGSLPLGLNILGSYLRGRSKEDWIDM 405  

                   LpRLrtsfgnsLDgkIekvLrvsYDgLhek.DqaLFLhIACfFNgekvdy
                   +p Lr+     LDgkI+k+LrvsYDgL +++Dqa+F+hIAC+FN e +++
  gi|7485310   406 MPGLRN----KLDGKIQKTLRVSYDGLASEdDQAIFRHIACIFNFEACSD 451  

                   VkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqL
                   +k+lL+ds  L+V++GL +L+dKSLI+i+p+      ++t+eMH+LLq+ 
  gi|7485310   452 IKKLLEDS-GLNVTNGLINLVDKSLIRIEPK------QKTVEMHCLLQET 494  

                   GReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDt
                   +Re I+r+Qs+d  +PgKR+FLvD ++I dVL++++Gt+  +VlGIslD+
  gi|7485310   495 ARE-IIRAQSFD--DPGKREFLVDGKDIADVLDNCSGTR--KVLGISLDM 539  

                   seieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   +eie el+ + +AF++M NL+FL+ y+++++++++   
  gi|7485310   540 DEIE-ELHLQVDAFKKMLNLRFLKLYTNTNISEKE    573  

gi|10178008|dbj|BAB11460.1|: domain 1 of 1, from 179 to 568: score 864.6, E = 4e-255
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      rDF+++VG++aHl+k++sLLcL+s deV+M+GIwGPaGIGKTTIARA
  gi|1017800   179    RDFEEMVGLDAHLRKLDSLLCLNS-DEVKMIGIWGPAGIGKTTIARA 224  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L++qLS      +Fq+++Fm+nl+gsy+     S     +g+D+Y+  +K
  gi|1017800   225 LYNQLS-----TNFQFKCFMGNLKGSYK-----S-----IGVDNYD--WK 257  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   L+LQ+q+LSkILnq+D+k + HLG i+++L d+KVLI++DDVDdleQL A
  gi|1017800   258 LNLQNQLLSKILNQNDVKTD-HLGGIKDWLEDKKVLIVIDDVDDLEQLLA 306  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInht.IYeVgfPSkeeALqIFC
                   LAke +WFG+GSRIIVTT+Dk ++k   +n++++Y+Vg+P+++ AL+I+C
  gi|1017800   307 LAKEPSWFGSGSRIIVTTKDKTIMKTLLVNDNnFYHVGYPTNKVALEILC 356  

                   rsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedm
                   +sAF +++P+dGFeeL Ar+V+ L+GnLPL+L+V+GSsLRG sk++W+ +
  gi|1017800   357 LSAFQKSFPRDGFEEL-ARKVAYLCGNLPLCLSVVGSSLRGQSKHRWKLQ 405  

                   LpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyV
                     RL+t    sLD+kIe+vL+  Y++L++k+q LFLhIACfFN   ++ V
  gi|1017800   406 SDRLET----SLDRKIEDVLKSAYEKLSKKEQVLFLHIACFFNNTYISVV 451  

                   kalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLG
                   k+lLads nLDVr+GLk+LadK+L+his+        ++i MH LLqqLG
  gi|1017800   452 KTLLADS-NLDVRNGLKTLADKCLVHISR-------VDRIFMHPLLQQLG 493  

                   ReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDts
                   R  IV +Qs   deP+KRqFLv+aeeI+dVL+++TGtg  sVlGIs+D+s
  gi|1017800   494 RY-IVLEQS---DEPEKRQFLVEAEEIRDVLANETGTG--SVLGISFDMS 537  

                   eieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   +++ e++Is +AFe MrNL+FLriy++  ++++k   
  gi|1017800   538 KVS-EFSISGRAFEAMRNLRFLRIYRR--SSSKK    568  

gi|10177708|dbj|BAB11082.1|: domain 1 of 1, from 177 to 570: score 864.5, E = 4.3e-255
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      +DF+++VGiE+H+++m+ LL L+  +eVrMVGIwG++GIGKTTIARA
  gi|1017770   177    KDFENFVGIEDHIANMSVLLKLEA-EEVRMVGIWGSSGIGKTTIARA 222  

                   LfsqLSerhFq.ssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGm
                   Lf+qLS rhF+ s+F+++aF++++r      ei+S+    a++D+++  m
  gi|1017770   223 LFNQLS-RHFPvSKFIDRAFVYKSR------EIFSR----ANPDDHN--M 259  

                   KLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLd
                   KLhLQe++LS+IL++ DikI+ HLGv++ERL++qKVLIi DD+Dd++ Ld
  gi|1017770   260 KLHLQEKLLSEILRMPDIKID-HLGVLGERLQHQKVLIIVDDLDDQVILD 308  

                   ALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFC
                    L+++tqWFG+GSRII +T++k++L+aH+I+h IYeV++P++++AL ++C
  gi|1017770   309 SLVGQTQWFGSGSRIIAVTNNKHFLRAHEIDH-IYEVSLPTQQHALAMLC 357  

                   rsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedm
                   +sAF+++sPp+GFe+L +++V++++++LPLGL+VlGS+LRG++ke+W++m
  gi|1017770   358 QSAFRKKSPPEGFEML-VVQVARHVDSLPLGLNVLGSYLRGRDKEYWMEM 406  

                   LpRLrtsfgnsLDgkIekvLrvsYDgLhek.DqaLFLhIACfFNgekvdy
                   LpRL++    +L++kIek+Lr+sYDgL +++D+a+F+hIAC+FN+++v++
  gi|1017770   407 LPRLEN----GLHDKIEKILRISYDGLGSEeDKAIFRHIACLFNHMEVTT 452  

                   VkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqL
                   +++lL    +L +++GLk+L+dKS+Ih++         g++eMH++Lq++
  gi|1017770   453 ITSLLT---DLGINIGLKNLVDKSIIHVR--------RGCVEMHRMLQEM 491  

                   GReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDt
                   GR+ IVr+Qsid  +PgKR+FLvD+++I+dVL++++Gt+  +VlGIsl+t
  gi|1017770   492 GRK-IVRTQSID--KPGKREFLVDPNDISDVLSEGIGTQ--KVLGISLNT 536  

                   seieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                    ei+ el+++e+AF+gM+NL+FL+i+ k f+++g    
  gi|1017770   537 GEID-ELYVHESAFKGMSNLRFLEIDSKNFGKAGR    570  

gi|10177707|dbj|BAB11081.1|: domain 1 of 1, from 177 to 571: score 862.2, E = 2.1e-254
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      +DF+d+VG+E+H+++m+ LL+L+sk eV+MVGIwG++GIGKTTIARA
  gi|1017770   177    KDFEDFVGLEDHIANMSALLDLESK-EVKMVGIWGSSGIGKTTIARA 222  

                   LfsqLSerhFq.ssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGm
                   Lf+ L+ rhFq ++F+++ F +++r      ei+S+    a++D+++  m
  gi|1017770   223 LFNNLF-RHFQvRKFIDRSFAYKSR------EIHSS----ANPDDHN--M 259  

                   KLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLd
                   KLhLQe fLS+IL++ +ikI+ HLGv++ERL++qKVLIi+DDVDd++ Ld
  gi|1017770   260 KLHLQESFLSEILRMPNIKID-HLGVLGERLQHQKVLIIIDDVDDQVILD 308  

                   ALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFC
                    L+++tqWFG+GSRIIV+T++k++L aHgI+  +YeV++P++e+AL ++C
  gi|1017770   309 SLVGKTQWFGNGSRIIVVTNNKHFLTAHGIDR-MYEVSLPTEEHALAMLC 357  

                   rsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedm
                   +sAF+++sPp+GFe+L +++V++ aG+LPL L+VlGS+L Gk+ke+W+dm
  gi|1017770   358 QSAFKKKSPPEGFEML-VVQVARYAGSLPLVLKVLGSYLSGKDKEYWIDM 406  

                   LpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyV
                   LpRL++    +L++kIe +Lr+sYDgL ++Dqa+F+hIAC+FN+++v+++
  gi|1017770   407 LPRLQN----GLNDKIERILRISYDGLESEDQAIFRHIACIFNHMEVTTI 452  

                   kalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLG
                   k+lLa+s     ++GL++L+dKS+Ih++        +g++eMH LLq++G
  gi|1017770   453 KSLLANS-IYGANVGLQNLVDKSIIHVR--------WGHVEMHPLLQEMG 493  

                   ReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDts
                   R+ IVr+Qsi+  +P+KR+FLvD+++IcdVL+++++t+  +VlGIsl+ts
  gi|1017770   494 RK-IVRTQSIG--KPRKREFLVDPNDICDVLSEGIDTQ--KVLGISLETS 538  

                   eieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   +i+ el+++e+AF++MrNL+FL+i +++f+ ++    
  gi|1017770   539 KID-ELCVHESAFKRMRNLRFLKIGTDIFGEENR    571  

gi|9279731|dbj|BAB01321.1|: domain 1 of 1, from 197 to 588: score 860.4, E = 7.1e-254
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      +DF+ l+G++aH+e+m+ LL+Ld  d+VrM+GIwGP+GIGKTTIAR+
  gi|9279731   197    WDFEALIGMGAHMENMRALLRLDL-DDVRMIGIWGPPGIGKTTIARF 242  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L sq S     +sFqls +m n++++y         ++p +lDeYs  ++
  gi|9279731   243 LLSQVS-----KSFQLSTIMVNIKECY---------PSP-CLDEYS--VQ 275  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   L+LQ+++LSk++nqkDi+I+ HLGv++ERLkd+KV+++LDDVD+l QLdA
  gi|9279731   276 LQLQNKMLSKMINQKDIMIP-HLGVAQERLKDKKVFLVLDDVDQLGQLDA 324  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   LAket+WFGpGSRII+TTe+  LL+aH+Inh IY+V+f S++eA+qIFC+
  gi|9279731   325 LAKETRWFGPGSRIIITTENLRLLMAHRINH-IYKVEFSSTDEAFQIFCM 373  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   +AFgQ+ P++GF+eL +reVt+LaG LPLGL+V+GSsLRG+sk+eW+++L
  gi|9279731   374 HAFGQKHPYNGFYEL-SREVTELAGGLPLGLKVMGSSLRGMSKQEWKRTL 422  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                   pRLrt    +LDgkIe++L +sY++L+++D++LFL+IACfFN++k+++V+
  gi|9279731   423 PRLRT----CLDGKIESILMFSYEALSHEDKDLFLCIACFFNYQKIKKVE 468  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                   ++Lad  +LDVrqGL vLa+KSLIhi          g  eMH+LL+qLGR
  gi|9279731   469 KHLADR-FLDVRQGLYVLAEKSLIHIG--------TGATEMHTLLVQLGR 509  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtse
                   e I ++Qs+  ++P+K  FLvD +eIc+ L+d+T +++r+++G+++D+s+
  gi|9279731   510 E-IAHTQST--NDPRKSLFLVDEREICEALSDETMDSSRRIIGMDFDLSK 556  

                   iee.elnIsekAFegMrNLqFLriykksfrddgk<-*
                   ++e++ nIsek +++M+NLqF r++ +  +++ +   
  gi|9279731   557 NGEeVTNISEKGLQRMSNLQFIRFDGR--SCARH    588  

gi|9954758|gb|AAG09109.1|AC009323_20: domain 1 of 1, from 183 to 570: score 860.2, E = 8.5e-254
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      rDFd+++G+EaHl+k++sLL+Ld+ d++++VGI+GPaGIGK+TIARA
  gi|9954758   183    RDFDGMIGLEAHLRKIESLLDLDY-DGAKIVGISGPAGIGKSTIARA 228  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L+s LS     ++Fq+++Fm+nl            e++++gl eY+  + 
  gi|9954758   229 LHSVLS-----KRFQHNCFMDNLH-----------ESYKIGLVEYG--LR 260  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   L+LQeq+LSkILn ++i+I  HLGvi+ERL+dqKVLIiLDDV+ l+QLdA
  gi|9954758   261 LRLQEQLLSKILNLDGIRIA-HLGVIRERLHDQKVLIILDDVESLDQLDA 309  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   LA+ ++WFGpGSR+IVTTe+k++L++HgI + IY+VgfPS +eAL+IFC+
  gi|9954758   310 LAN-IEWFGPGSRVIVTTENKEILQQHGISD-IYHVGFPSSKEALMIFCL 357  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   sAF+Q sPpd F++L A eV+kL+G+LPL+L+VlGSsLRGk+  +W+++L
  gi|9954758   358 SAFRQLSPPDRFMNL-AAEVAKLCGYLPLALHVLGSSLRGKNYSDWIEEL 406  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                   pRL+t    +LDg+Ie+vL+v+Y++LhekDqaLFL+IA+fFN++++dyV+
  gi|9954758   407 PRLQT----CLDGRIESVLKVGYESLHEKDQALFLYIAVFFNYQHADYVT 452  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                   ++La++ nL+Vr+GLk+La++ LIhi   + +   +g+++MH+LL  ++R
  gi|9954758   453 SMLAKT-NLNVRLGLKILANRHLIHIG--HGA---KGIVVMHRLLKVMAR 496  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtse
                   + ++ kQ+     P+KRq+LvD++eI++VL+++ G+g  s+ GIs+D+ e
  gi|9954758   497 Q-VISKQE-----PWKRQILVDTQEISYVLENAEGNG--SIAGISFDVGE 538  

                   ieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   i+ +l Is kAFe+M+NL+ L++y+ +f  +g+   
  gi|9954758   539 IN-KLTISAKAFERMHNLLLLKVYDPWFTGKGQ    570  

gi|10177584|dbj|BAB10815.1|: domain 1 of 1, from 182 to 572: score 860.0, E = 9.7e-254
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      +DF+dlVGiE+H++km+sLL+L+s +eVrMVGIwGP+GIGKTTIARA
  gi|1017758   182    NDFEDLVGIEDHITKMSSLLHLES-EEVRMVGIWGPSGIGKTTIARA 227  

                   LfsqLSerhFq.ssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGm
                   Lfs+LS ++Fq+s F++++F+++++      e++Sg    a+l +Y+  m
  gi|1017758   228 LFSRLS-CQFQsSVFIDKVFISKSM------EVYSG----ANLVDYN--M 264  

                   KLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLd
                   KLhLQ+ fL++I+++kDikIh   G++e + k++K LI++DD+Dd+++Ld
  gi|1017758   265 KLHLQRAFLAEIFDKKDIKIH--VGAMEKMVKHRKALIVIDDLDDQDVLD 312  

                   ALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFC
                   ALA++tqWFG+GSRIIV+Te+k++L+a +I+h IY+V++PS+ +AL++FC
  gi|1017758   313 ALADQTQWFGSGSRIIVVTENKHFLRANRIDH-IYKVCLPSNALALEMFC 361  

                   rsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedm
                   rsAF++nsPpd+F eL + eV+ +aGnLPLGL+VlGS+LRG +k +W+dm
  gi|1017758   362 RSAFKKNSPPDDFLEL-SSEVALRAGNLPLGLNVLGSNLRGINKGYWIDM 410  

                   LpRLrtsfgnsLDgkIekvLrvsYDgLhek.DqaLFLhIACfFNgekvdy
                   LpRL+     +LDgkI k+LrvsYDgL++++D a+F+hIAC+FNgekv++
  gi|1017758   411 LPRLQ-----GLDGKIGKTLRVSYDGLNNRkDEAIFRHIACIFNGEKVSD 455  

                   VkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqL
                   +k lLa+s nLDV++GLk+L+d+SLI  +          t eMH+LLq+L
  gi|1017758   456 IKLLLANS-NLDVNIGLKNLVDRSLICER--------FNTLEMHSLLQEL 496  

                   GReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDt
                   G+e IVr+Qs+   +Pg+R+FLvD ++IcdVL++nTGt+  +VlGI lD+
  gi|1017758   497 GKE-IVRTQSN---QPGEREFLVDLKDICDVLEHNTGTK--KVLGITLDI 540  

                   seieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   +e++ el+I+e++F+gM+NL+FL+iy+k  + d+k   
  gi|1017758   541 DETD-ELHIHESSFKGMHNLLFLKIYTK--KLDQK    572  

gi|9758704|dbj|BAB09158.1|: domain 1 of 1, from 208 to 598: score 854.2, E = 5.3e-252
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      +DFd++VGiEaH +++ sLL+Ld  +eVrM+GIwGPaGIGKTTI R+
  gi|9758704   208    KDFDEFVGIEAHTTEITSLLQLDL-EEVRMIGIWGPAGIGKTTISRV 253  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L+++L+     ++Fql a+++n++  y         +rp ++DeYs  +K
  gi|9758704   254 LYNKLF-----HQFQLGAIIDNIKVRY---------PRP-CHDEYS--AK 286  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   L+LQ+++LS+++nqkD+ ++ HLGv++ERLkd+KVL++LDDVD l+QLdA
  gi|9758704   287 LQLQKELLSQMINQKDMVVP-HLGVAQERLKDKKVLLVLDDVDGLVQLDA 335  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   +Ak+ qWFG GSRIIV+T+D +LLkaHgI++ IY+V+fP+ +eAL+IFC+
  gi|9758704   336 MAKDVQWFGLGSRIIVVTQDLKLLKAHGIKY-IYKVDFPTSDEALEIFCM 384  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   +AFg++sP+ GFe++ Ar Vt+LaG+LPLGLrV+GS+LR++sk+eW + +
  gi|9758704   385 YAFGEKSPKVGFEQI-ARTVTTLAGKLPLGLRVMGSYLRRMSKQEWAKSI 433  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                   pRLrt    sLD++Ie+vL++sY++L e++++LFLhI CfF+ e +++++
  gi|9758704   434 PRLRT----SLDDDIESVLKFSYNSLAEQEKDLFLHITCFFRRERIETLE 479  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                    +La++ ++D+rqGL++LadKSL + +         g ieMHnLL+qLG 
  gi|9758704   480 VFLAKK-SVDMRQGLQILADKSLLSLN--------LGNIEMHNLLVQLGL 520  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtse
                   + IVrkQsi  ++PgKRqFLvD+e+Ic+VLtd+TGt+  + +GI+l++s+
  gi|9758704   521 D-IVRKQSI--HKPGKRQFLVDTEDICEVLTDDTGTR--TLIGIDLELSG 565  

                   iee.elnIsekAFegMrNLqFLriykksfrddgk<-*
                   + e+++nIse+AFe+M+NLqFLr++  + +d  +   
  gi|9758704   566 VIEgVINISERAFERMCNLQFLRFHHPY-GDRCH    598  

gi|12324938|gb|AAG52417.1|AC011622_5: domain 1 of 1, from 210 to 600: score 853.3, E = 1e-251
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      rDF+d+VG E Hlek++sLL+Ld++de+++VGI+GPaGIGKTTIARA
  gi|1232493   210    RDFEDMVGVETHLEKIQSLLHLDNDDEAMIVGIYGPAGIGKTTIARA 256  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L+s+LS     ++Fql++Fmenlr        gS   ++++lDeY+  +K
  gi|1232493   257 LHSLLS-----DRFQLTCFMENLR--------GS---YNSSLDEYG--LK 288  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   L+LQeq+LSkILnq ++++  +L +i+ +L+dqKVLIiLDDVDdl+QL+A
  gi|1232493   289 LQLQEQLLSKILNQTGMRVY-NLSAIQGMLCDQKVLIILDDVDDLKQLEA 337  

                   LAketqWFGpGSRIIVTTeDkqLLkaHg.InhtIYeVgfPSkeeALqIFC
                   LA+et+WFGpGSR++VTTe+++LLk+H++I++t Y V+fP+++eA qIFC
  gi|1232493   338 LANETKWFGPGSRVVVTTENQELLKQHDdIKNT-YYVDFPTQKEARQIFC 386  

                   rsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedm
                   r+ F+Q++P+dGFe+L +++V+kL+ +LPLGL+V+G +LR k++++Wed+
  gi|1232493   387 RYGFKQSTPQDGFENL-SERVIKLCSKLPLGLSVMGLYLRKKTEDDWEDI 435  

                   LpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyV
                   L+RL++sf +s D++Ie vLrv+YDgLhekDq LFL+IA+fFN++++d+V
  gi|1232493   436 LHRLESSF-DSVDRNIERVLRVGYDGLHEKDQLLFLLIAFFFNYKDDDHV 484  

                   kalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLG
                   ka+Lad+ nL+Vr+GLk+L +KSLI+ s++gn       i+MH+LLqq+G
  gi|1232493   485 KAMLADN-NLNVRLGLKTLEYKSLIQRSSGGN-------IVMHKLLQQVG 526  

                   ReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDts
                   ReA V++Q+     P+KRq+L+Da+eIc+VL+ ++G    +V+GIs+++s
  gi|1232493   527 REA-VQRQE-----PWKRQILIDAHEICNVLETDSGCA--NVMGISFNVS 568  

                   eieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                    i + ++Is kAF+ MrNL+FL+iy++  r+d +   
  gi|1232493   569 TIPNGVHISAKAFQNMRNLRFLSIYET--RRDVN    600  

gi|12322541|gb|AAG51270.1|AC027135_11: domain 1 of 1, from 178 to 572: score 849.9, E = 1e-250
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      +D ++lVGiE+H+++m++LL+L+sk eVrMVGI+G++GIGKTTIARA
  gi|1232254   178    KDSEELVGIEDHIAEMSLLLQLESK-EVRMVGISGSSGIGKTTIARA 223  

                   LfsqLSerhFq.ssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGm
                   Lf +LS rhFq+s F+++aF++++r      +i+Sg    a++D+ +  m
  gi|1232254   224 LFKRLS-RHFQgSTFIDRAFVSYSR------NIYSG----ANPDDPN--M 260  

                   KLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLd
                   KL+LQ +fLS+IL++kDikI+ +  ++eERLk+qKVLIi+DD+Dd+++Ld
  gi|1232254   261 KLQLQGHFLSEILGKKDIKID-DPAALEERLKHQKVLIIIDDLDDIMVLD 309  

                   ALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFC
                   +L+++tqWFG+GSRIIV+T+Dk++L aHgI+h IYeV+fP++ +A+q++C
  gi|1232254   310 TLVGQTQWFGYGSRIIVVTNDKHFLIAHGIDH-IYEVSFPTDVHACQMLC 358  

                   rsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedm
                   +sAF+Qn +p GFe+L ++ V+++aGn+PLGL+ lG +LR+++ e+W+dm
  gi|1232254   359 QSAFKQNYAPKGFEDL-VVDVVRHAGNFPLGLNLLGKYLRRRDMEYWMDM 407  

                   LpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyV
                   LpRL++    ++DgkIek+Lr+sYDgL ++Dq++F+hIAC+FN+++v+++
  gi|1232254   408 LPRLEN--SLRIDGKIEKILRISYDGLESEDQEIFRHIACLFNHMEVTTI 455  

                   kalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLG
                   k+lLads   DV++ L++LadKSLIh++        +g+++MH+ Lq++G
  gi|1232254   456 KSLLADS---DVSFALENLADKSLIHVR--------QGYVVMHRSLQEMG 494  

                   ReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDts
                   R+ IVr Qsid  +Pg+R+FLvD+++I+d+L+ +TGt+  +VlGIslD++
  gi|1232254   495 RK-IVRIQSID--KPGEREFLVDPNDIHDILNACTGTQ--KVLGISLDIR 539  

                   eieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   +i  el+++e+AF+gM+NL+FL+i++   + dg    
  gi|1232254   540 NIR-ELDVHERAFKGMSNLRFLEIKNFGLKEDGL    572  

gi|12597847|gb|AAG60157.1|AC074360_22: domain 1 of 1, from 178 to 572: score 849.9, E = 1e-250
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      +D ++lVGiE+H+++m++LL+L+sk eVrMVGI+G++GIGKTTIARA
  gi|1259784   178    KDSEELVGIEDHIAEMSLLLQLESK-EVRMVGISGSSGIGKTTIARA 223  

                   LfsqLSerhFq.ssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGm
                   Lf +LS rhFq+s F+++aF++++r      +i+Sg    a++D+ +  m
  gi|1259784   224 LFKRLS-RHFQgSTFIDRAFVSYSR------NIYSG----ANPDDPN--M 260  

                   KLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLd
                   KL+LQ +fLS+IL++kDikI+ +  ++eERLk+qKVLIi+DD+Dd+++Ld
  gi|1259784   261 KLQLQGHFLSEILGKKDIKID-DPAALEERLKHQKVLIIIDDLDDIMVLD 309  

                   ALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFC
                   +L+++tqWFG+GSRIIV+T+Dk++L aHgI+h IYeV+fP++ +A+q++C
  gi|1259784   310 TLVGQTQWFGYGSRIIVVTNDKHFLIAHGIDH-IYEVSFPTDVHACQMLC 358  

                   rsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedm
                   +sAF+Qn +p GFe+L ++ V+++aGn+PLGL+ lG +LR+++ e+W+dm
  gi|1259784   359 QSAFKQNYAPKGFEDL-VVDVVRHAGNFPLGLNLLGKYLRRRDMEYWMDM 407  

                   LpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyV
                   LpRL++    ++DgkIek+Lr+sYDgL ++Dq++F+hIAC+FN+++v+++
  gi|1259784   408 LPRLEN--SLRIDGKIEKILRISYDGLESEDQEIFRHIACLFNHMEVTTI 455  

                   kalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLG
                   k+lLads   DV++ L++LadKSLIh++        +g+++MH+ Lq++G
  gi|1259784   456 KSLLADS---DVSFALENLADKSLIHVR--------QGYVVMHRSLQEMG 494  

                   ReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDts
                   R+ IVr Qsid  +Pg+R+FLvD+++I+d+L+ +TGt+  +VlGIslD++
  gi|1259784   495 RK-IVRIQSID--KPGEREFLVDPNDIHDILNACTGTQ--KVLGISLDIR 539  

                   eieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   +i  el+++e+AF+gM+NL+FL+i++   + dg    
  gi|1259784   540 NIR-ELDVHERAFKGMSNLRFLEIKNFGLKEDGL    572  

gi|3860163|gb|AAC72977.1|: domain 1 of 1, from 221 to 611: score 848.5, E = 2.9e-250
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      +DFdd+VG+ aH+e+ ++LL+Ld  de+rM+GIwGP+GIGKTTIAR+
  gi|3860163   221    KDFDDFVGMAAHMERTEQLLRLDL-DEARMIGIWGPPGIGKTTIARF 266  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   Lf+q S     ++Fqlsa+m n++g+y         +rp ++DeYs  ++
  gi|3860163   267 LFNQVS-----DRFQLSAIMVNIKGCY---------PRP-CFDEYS--AQ 299  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   L+LQ+q+LS+++n+kDi+I+ HLGv++ERL+d+KV+++LD VD+l QLdA
  gi|3860163   300 LQLQNQMLSQMINHKDIMIS-HLGVAQERLRDKKVFLVLDEVDQLGQLDA 348  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   LAk+t+WFGpGSRII+TTeD+ +LkaHgInh +Y+V++PS++eA+qIFC+
  gi|3860163   349 LAKDTRWFGPGSRIIITTEDQGILKAHGINH-VYKVEYPSNDEAFQIFCM 397  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                    AFgQ++P++GF +L A+eV  LaG+LPLGL+VlGS+LRG+sk eWe++L
  gi|3860163   398 NAFGQKQPYEGFCDL-AWEVKALAGELPLGLKVLGSALRGMSKPEWERTL 446  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                   pRLrt    sLDgkI  + ++sYD+L+++D++LFL+IAC+FN e  ++V+
  gi|3860163   447 PRLRT----SLDGKIGGIIQFSYDALCDEDKYLFLYIACLFNNESTTKVE 492  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                   + La++ +LDV qG +vLa+KSLI+++  g+e      i MH+LL+q+GR
  gi|3860163   493 EVLANK-FLDVGQGIHVLAQKSLISFE--GEE------IQMHTLLEQFGR 533  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtse
                   e   rkQ + h+ + K+q Lv  ++Ic+VL+d+T ++ r+++GI+lD+s+
  gi|3860163   534 E-TSRKQFV-HHRYTKHQLLVGERDICEVLNDDTIDS-RRFIGIHLDLSK 580  

                   ieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   +eeelnIsekA+e+++++qF ri++k   ++ +   
  gi|3860163   581 NEEELNISEKALERIHDFQFVRINDK--NHALH    611  

gi|9758205|dbj|BAB08679.1|: domain 1 of 1, from 180 to 565: score 845.2, E = 2.7e-249
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      ++F+dlVGiEaHl++ ks+LcL+s +e+rMVGI GP+GIGKTTIAR+
  gi|9758205   180    NCFGDLVGIEAHLKAVKSILCLES-EEARMVGILGPSGIGKTTIARI 225  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L+s+LS     s+F  ++F + +r+++               D+Y+  mK
  gi|9758205   226 LYSKLS-----SQFDYHVFGSFKRTNQ---------------DNYG--MK 253  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   L+++eqfLS+IL+qkD+kI+ +LGv+++RLk++KVLI+LDDVD+le+L++
  gi|9758205   254 LSWEEQFLSEILDQKDLKIS-QLGVVKQRLKHKKVLIVLDDVDNLELLKT 302  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   L+++t WFGpGSRIIVTT+D+ LLk+H I+h IYeVg+PS+++AL I+Cr
  gi|9758205   303 LVGQTGWFGPGSRIIVTTQDRILLKSHKIDH-IYEVGYPSRKLALRILCR 351  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   sAF +nsPpdGF++L A+eVt+L+GnLPL+L+++GSsL+G++keeW++m+
  gi|9758205   352 SAFDRNSPPDGFMQL-ANEVTELVGNLPLALNIMGSSLKGRDKEEWIEMM 400  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                   p Lr+s     Dg+I k+LrvsYD+Lh + q++FL+IAC+ N++ v+y+ 
  gi|9758205   401 PSLRNS---LVDGEILKTLRVSYDRLHGNYQEIFLYIACLLNCCGVEYII 447  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                   ++L+d+      +GLk+La+KSLIhispl      d+t+eMH+LLq+LGR
  gi|9758205   448 SMLGDN----AIIGLKILAEKSLIHISPL------DKTVEMHSLLQKLGR 487  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtse
                   + IVr +s++  +PgKR+FL Dae+IcdV+tdnTGt+  +VlGIsl+t e
  gi|9758205   488 K-IVRDESFG--NPGKRRFLLDAEDICDVFTDNTGTE--TVLGISLNTLE 532  

                   ieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   i+ +l++++k+F+gM+NLqFL+++++++r +g+   
  gi|9758205   533 INGTLSVDDKSFQGMHNLQFLKVFENWRRGSGE    565  

gi|10177588|dbj|BAB10819.1|: domain 1 of 1, from 177 to 572: score 842.3, E = 2e-248
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         ++ +GiE+H+++m+ LL+L+  +eVrMVGIwG++GIGKTTIARA
  gi|1017758   177    DSAENSIGIEDHIANMSVLLQLEA-EEVRMVGIWGSSGIGKTTIARA 222  

                   LfsqLSerhFq.ssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGm
                   Lf+qLS rhF+ s+F+++aF++++r      e++ g    a++D+ +  m
  gi|1017758   223 LFNQLS-RHFPvSKFIDRAFVYKSR------ETYKG----ANPDDPN--M 259  

                   KLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLd
                   KLhLQ  fLS+IL++kDikI+ HLG+++ERLk+qK LIi+DD+Ddl++Ld
  gi|1017758   260 KLHLQGCFLSEILGKKDIKID-HLGALGERLKHQKTLIIIDDLDDLVVLD 308  

                   ALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFC
                    L+++t+WFG+GSRIIV+T++kq+L+aHgI+h IYeV++PSke A ++FC
  gi|1017758   309 SLVGKTNWFGCGSRIIVITNNKQFLRAHGIDH-IYEVSLPSKERAQEMFC 357  

                   rsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedm
                   +sAFg+nsPp+GFeeL ++e+++LaG+LPLGL V GS+LRG++ke+W++m
  gi|1017758   358 QSAFGENSPPEGFEEL-VVEIAWLAGSLPLGLTVFGSALRGRKKEYWVKM 406  

                   LpRLrtsfgnsLDgkIekvLrvsYDgLhek.DqaLFLhIACfFNgekvdy
                   LpRL++     LDg+Ie++L+vsYD+  + +DqaLF++IAC+FN+ kv +
  gi|1017758   407 LPRLQN----DLDGNIEETLKVSYDAIGNVkDQALFRLIACLFNHVKVRD 452  

                   VkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqL
                   ++ lLads  LDV++ L++L+dKSLIh++        ++++eMH+LLq+ 
  gi|1017758   453 IELLLADS-GLDVNIALENLVDKSLIHVR--------NDHVEMHRLLQET 493  

                   GReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDt
                   GR  IVr Qs+d  +Pg+R+FLvD+++ + VL++++Gt+  +VlGIslDt
  gi|1017758   494 GRN-IVRSQSTD--NPGEREFLVDSNDSRTVLSEGIGTR--KVLGISLDT 538  

                   seieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   s+++ e++++e+AF+gM NL+FL i  k+f+ ++    
  gi|1017758   539 SKVS-EFCVHENAFKGMGNLLFLDISSKTFIEEEV    572  

gi|9758062|dbj|BAB08641.1|: domain 1 of 1, from 173 to 556: score 841.9, E = 2.7e-248
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      +DFd +VG+E H+++++sLL Ld+ ++Vr+VGI+GPaGIGKTTIARA
  gi|9758062   173    KDFDAFVGLEFHIRELSSLLYLDY-EQVRIVGICGPAGIGKTTIARA 218  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L s+LS     s+Fq s+Fmen+r        gS    ++glDeY+  +K
  gi|9758062   219 LQSLLS-----SNFQRSCFMENVR--------GS---LNIGLDEYG--LK 250  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   L LQe++LSkI+nqk+++I+ HLG+i++RL+dqKVLIiLDDV+dl+ L A
  gi|9758062   251 LDLQERLLSKIMNQKGMRIE-HLGTIRDRLHDQKVLIILDDVNDLD-LYA 298  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   LA++t+WFGpGSRIIVTTeD +LL+ H+In+ +Y+V+fPS++eAL+IFCr
  gi|9758062   299 LADQTTWFGPGSRIIVTTEDNELLQKHDINN-VYHVDFPSRKEALEIFCR 347  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   +AF+Q+s+pd   +L A++Vt+L+GnLPLGL+V GSsL+Gk+++eWe ++
  gi|9758062   348 CAFRQSSAPDTILKL-AERVTELCGNLPLGLCVIGSSLHGKTEDEWEILI 396  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                   +RL+     sLD++ e  Lrv+YD+Lhe++qaLFL IA+fFN++++ +V 
  gi|9758062   397 RRLEI----SLDRDNEAQLRVGYDSLHENEQALFLSIAVFFNYKDRQLVM 442  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                   a+L ds nLDV++GL +La+KSLIhis+       ++ i+MHnLLq++GR
  gi|9758062   443 AMLLDS-NLDVEYGLRTLANKSLIHISR-------NEKIVMHNLLQHVGR 484  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtse
                   +A +++Q+     P+KR++L+Da eIc+VL+++T+ +   V+GIs+D+s+
  gi|9758062   485 QA-IQRQE-----PWKRHILIDADEICNVLENDTDAR--IVSGISFDISR 526  

                   ieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   i+ e++ se+AF++++NLqFLr++k+  ++d+k   
  gi|9758062   527 IG-EVFLSERAFKRLCNLQFLRVFKT--GYDEK    556  

gi|10177589|dbj|BAB10820.1|: domain 1 of 1, from 216 to 611: score 841.6, E = 3.3e-248
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         ++ +GiE+H+++m+ LL L+  +eVrMVGIwG++GIGKTTIARA
  gi|1017758   216    DSAENSIGIEDHIANMSVLLKLEA-EEVRMVGIWGSSGIGKTTIARA 261  

                   LfsqLSerhFq.ssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGm
                   Lf+qLS rhF+ s+F+++aF++++r      e++ g    a++D+ +  m
  gi|1017758   262 LFNQLS-RHFPvSKFIDRAFVYKSR------ETYKG----ANPDDPN--M 298  

                   KLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLd
                   KLhLQ  fLS+IL++kDikI+ HLG+++ERLk+qK LIi+DD+Ddl++Ld
  gi|1017758   299 KLHLQGCFLSEILGKKDIKID-HLGALGERLKHQKTLIIIDDLDDLVVLD 347  

                   ALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFC
                    L+++t+WFG+GSRIIV+T++kq+L+aHgI+h IYeV++PSke A ++FC
  gi|1017758   348 SLVGKTNWFGCGSRIIVITNNKQFLRAHGIDH-IYEVSLPSKERAQEMFC 396  

                   rsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedm
                   +sAFg+nsPp+GFeeL ++e+++LaG+LPLGL V GS+LRG++ke+W++m
  gi|1017758   397 QSAFGENSPPEGFEEL-VVEIAWLAGSLPLGLTVFGSALRGRKKEYWVKM 445  

                   LpRLrtsfgnsLDgkIekvLrvsYDgLhek.DqaLFLhIACfFNgekvdy
                   LpRL++     LDg+Ie++L+vsYD+  + +DqaLF++IAC+FN+ kv +
  gi|1017758   446 LPRLQN----DLDGNIEETLKVSYDAIGNVkDQALFRLIACLFNHVKVRD 491  

                   VkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqL
                   ++ lLads  LDV++ L++L+dKSLIh++        ++++eMH+LLq+ 
  gi|1017758   492 IELLLADS-GLDVNIALENLVDKSLIHVR--------NDHVEMHRLLQET 532  

                   GReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDt
                   GR  IVr Qs+d  +Pg+R+FLvD+++ + VL++++Gt+  +VlGIslDt
  gi|1017758   533 GRN-IVRSQSTD--NPGEREFLVDSNDSRTVLSEGIGTR--KVLGISLDT 577  

                   seieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   s+++ e++++e+AF+gM NL+FL i  k+f+ ++    
  gi|1017758   578 SKVS-EFCVHENAFKGMGNLLFLDISSKTFIEEEV    611  

gi|11357256|pir||T48928: domain 1 of 1, from 267 to 655: score 841.5, E = 3.6e-248
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      rDFd+lVG++aH+ ++++LL+Ld  deVrM+GIwGP+GIGKTTIAR+
  gi|1135725   267    RDFDGLVGMRAHMDMLEQLLRLDL-DEVRMIGIWGPPGIGKTTIARF 312  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   Lf+q S     ++Fqlsa+m n++g+y         +rp ++DeYs  ++
  gi|1135725   313 LFNQVS-----DRFQLSAIMVNIKGCY---------PRP-CFDEYS--AQ 345  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   L+LQ+q+LS+++n+kDi+I+ HLGv++ERL+d+KV+++LD VD+l QLdA
  gi|1135725   346 LQLQNQMLSQMINHKDIMIS-HLGVAQERLRDKKVFLVLDEVDQLGQLDA 394  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   LAket+WFGpGSRII+TTeD   LkaHgInh +Y+V++PS++eA+qIFC+
  gi|1135725   395 LAKETRWFGPGSRIIITTEDLGVLKAHGINH-VYKVEYPSNDEAFQIFCM 443  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                    AFgQ++P++GF e+ A+eVt LaG+LPLGL+VlGS+LRGksk eWe++L
  gi|1135725   444 NAFGQKQPHEGFDEI-AWEVTCLAGELPLGLKVLGSALRGKSKREWERTL 492  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                   pRL+t    sLDgkI ++ ++sYD L+++D++LFL+IAC+FNge  ++Vk
  gi|1135725   493 PRLKT----SLDGKIGSIIQFSYDVLCDEDKYLFLYIACLFNGESTTKVK 538  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                   +lL++  +LDV+qGL+ La+KSLI+++         ++i MH+LL+q+GR
  gi|1135725   539 ELLGK--FLDVKQGLHLLAQKSLISFD--------GERIHMHTLLEQFGR 578  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtse
                   e   rkQ + h+   KRq Lv a+ Ic+VL+d+T ++ r+++GI+l++s+
  gi|1135725   579 E-TSRKQFV-HHGFTKRQLLVGARGICEVLDDDTTDS-RRFIGIHLELSN 625  

                   ieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   +eeelnIsek++e+ +++ F ri+ +   ++++   
  gi|1135725   626 TEEELNISEKVLERVHDFHFVRIDAS---FQPE    655  

gi|10176947|dbj|BAB10096.1|: domain 1 of 1, from 181 to 572: score 841.3, E = 4.1e-248
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      +DF++++GiE H+ekm +LLcL+  d+VrMVGIwGPaGIGKTTIAR+
  gi|1017694   181    NDFENIIGIESHMEKMVQLLCLND-DDVRMVGIWGPAGIGKTTIARV 226  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L+s++S      +F++++Fmen+rg+y        +++  +  eY+  ++
  gi|1017694   227 LHSRFS-----GDFRFTVFMENVRGNY--------QRIVDSGGEYN--LQ 261  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                    +LQ++fL  I+nqkD kI+ HL+ ieERLk qKVLI+L DVD++eQL+A
  gi|1017694   262 ARLQKEFLPIIFNQKDRKIN-HLWKIEERLKKQKVLIVLGDVDKVEQLEA 310  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   LA+et+WFGpGSRIIVTT+Dkq+L  H+Inh IYeV++P+++ AL+I+C+
  gi|1017694   311 LANETRWFGPGSRIIVTTKDKQILVGHEINH-IYEVKLPCRKTALEILCL 359  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   +AF+Qn +pd+F++  ++eV++L G+LPLGLrVlGS++RGksk++W+ +L
  gi|1017694   360 YAFKQNVAPDDFMDV-VVEVAELSGHLPLGLRVLGSHMRGKSKDRWKLEL 408  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                    RL t    sLD+k+ek+L++sYD+Lh +D+aLFLhIAC+FNge++d+Vk
  gi|1017694   409 GRLTT----SLDEKVEKILKISYDDLHIRDKALFLHIACMFNGENIDLVK 454  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                   ++L +s +LDV++GL+ L dKSLI+i++       d+ i+MH+LL ++G+
  gi|1017694   455 QMLVNS-DLDVSLGLQLLLDKSLIQIND-------DREIVMHSLLLKMGK 496  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtse
                   e +V+++s    ePgKRqFL++++e c++L++nTG++  +VlGIslDtse
  gi|1017694   497 E-VVCQHS---SEPGKRQFLFNTKETCNILSNNTGSE--AVLGISLDTSE 540  

                   ieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   i++ +++se++Fe MrNL+FLr+y+k ++d+++   
  gi|1017694   541 IQNDVFMSERVFEDMRNLKFLRFYNK-KIDENP    572  

gi|12325008|gb|AAG52450.1|AC010852_7: domain 1 of 1, from 185 to 566: score 840.3, E = 8.3e-248
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      rDF+++VG+EaHl++m+sLL+Ld+ d+V+MVGI+GPaGIGKTTIARA
  gi|1232500   185    RDFNGMVGLEAHLTEMESLLDLDY-DGVKMVGISGPAGIGKTTIARA 230  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L s+LS     ++Fql++F++nl+           e+  ++lDe      
  gi|1232500   231 LQSRLS-----NKFQLTCFVDNLK-----------ESFLNSLDE------ 258  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   L+LQeqfL+k+Ln+++i+I+ H GvieERL+ q+VLIiLDDV++++QL+A
  gi|1232500   259 LRLQEQFLAKVLNHDGIRIC-HSGVIEERLCKQRVLIILDDVNHIMQLEA 307  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   LA+et+WFG+GSRI+VTTe+k++L++HgIn+  Y+VgfPS+e A++I+Cr
  gi|1232500   308 LANETTWFGSGSRIVVTTENKEILQQHGIND-LYHVGFPSDEQAFEILCR 356  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   +AF++++  +GFe+L Ar+VtkL+GnLPLGLrVlGSsLRGk++eeWe+++
  gi|1232500   357 YAFRKTTLSHGFEKL-ARRVTKLCGNLPLGLRVLGSSLRGKNEEEWEEVI 405  

                   pRLrtsfgnsLD.gkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyV
                   +RL+t     LD+++Ie+vLrv+Y +Lhe++q+LFLhIA+fFN+ + d+V
  gi|1232500   406 RRLET----ILDhQDIEEVLRVGYGSLHENEQSLFLHIAVFFNYTDGDLV 451  

                   kalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLG
                   ka+  d+ nLD+++GLk+LadKSLI+is++++       i+ H+LLqq+G
  gi|1232500   452 KAMFTDN-NLDIKHGLKILADKSLINISNNRE-------IVIHKLLQQFG 493  

                   ReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDts
                   R+A V+k++     P+K+++L+ a eIcdVL+++TGt+  +++GIs+D+s
  gi|1232500   494 RQA-VHKEE-----PWKHKILIHAPEICDVLEYATGTK--AMSGISFDIS 535  

                   eieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   +++ e++Is k+F++++NL+FL+++k+  rddg+   
  gi|1232500   536 GVD-EVVISGKSFKRIPNLRFLKVFKS--RDDGN    566  

gi|3860165|gb|AAC72978.1|: domain 1 of 1, from 254 to 643: score 838.1, E = 3.6e-247
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      rDF++lVG++aH+ ++++LL+L   deVrM+GIwGP+GIGKTTIAR+
  gi|3860165   254    RDFNGLVGMRAHMDMLEQLLRLVL-DEVRMIGIWGPPGIGKTTIARF 299  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   Lf+q S     ++Fqlsa+m n++g+y         +rp ++DeYs  ++
  gi|3860165   300 LFNQVS-----DRFQLSAIMVNIKGCY---------PRP-CFDEYS--AQ 332  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   L+LQ+q+LS+++n+kDi+I+ HLGv++ERL+d+KV+++LD VD+l QLdA
  gi|3860165   333 LQLQNQMLSQMINHKDIMIS-HLGVAQERLRDKKVFLVLDEVDQLGQLDA 381  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   LAket+WFGpGSRII+TTeD   LkaHgInh +Y+Vg+PS++eA+qIFC+
  gi|3860165   382 LAKETRWFGPGSRIIITTEDLGVLKAHGINH-VYKVGYPSNDEAFQIFCM 430  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                    AFgQ++P++GF e+ AreV  LaG+LPLGL+VlGS+LRGksk eWe++L
  gi|3860165   431 NAFGQKQPHEGFDEI-AREVMALAGELPLGLKVLGSALRGKSKPEWERTL 479  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                   pRL+t    sLDgkI ++ ++sYD+L+++D++LFL+IAC+FN+e  ++V+
  gi|3860165   480 PRLKT----SLDGKIGSIIQFSYDALCDEDKYLFLYIACLFNKESTTKVE 525  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                    lL++  +LDVrqGL++La+KSLI+i+        dg i MH+LL+q+GR
  gi|3860165   526 GLLGK--FLDVRQGLHILAQKSLISIE--------DGNIYMHTLLEQFGR 565  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtse
                   e   rkQ i h+ + K+q Lv  ++Ic+VL+d+T ++ r+++GI+lD+++
  gi|3860165   566 E-TSRKQFI-HHGYTKHQLLVGERDICEVLNDDTIDS-RRFIGINLDLYK 612  

                   ieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   + eelnIsekA+e+++++qF ri+ k   ++ +   
  gi|3860165   613 NVEELNISEKALERIHDFQFVRINGK--NHALH    643  

gi|11357250|pir||T47442: domain 1 of 1, from 263 to 658: score 836.1, E = 1.5e-246
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      rDFd+lVG++aH+ ++++LL+Ld  deVrM+GIwGP+GIGKTTIAR+
  gi|1135725   263    RDFDGLVGMRAHMDMLEQLLRLDL-DEVRMIGIWGPPGIGKTTIARF 308  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   Lf+q S     ++Fqlsa++ n+rg+y         +rp ++DeYs  ++
  gi|1135725   309 LFNQVS-----DRFQLSAIIVNIRGIY---------PRP-CFDEYS--AQ 341  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   L+LQ+q+LS+++n+kDi+I+ HLGv++ERL+d+KV+++LD VD+l QLdA
  gi|1135725   342 LQLQNQMLSQMINHKDIMIS-HLGVAQERLRDKKVFLVLDEVDQLGQLDA 390  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   LAket+WFGpGSRII+TTeD   LkaHgInh +Y+V++PS++eA+qIFC+
  gi|1135725   391 LAKETRWFGPGSRIIITTEDLGVLKAHGINH-VYKVKYPSNDEAFQIFCM 439  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                    AFgQ++P++GF e+ A+eV  LaG+LPLGL+VlGS+LRGksk eWe++L
  gi|1135725   440 NAFGQKQPHEGFDEI-AWEVMALAGELPLGLKVLGSALRGKSKPEWERTL 488  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                   pRL+t    sLDg+I ++ ++sYDgL+++D++L L+IAC+FN+e  ++V+
  gi|1135725   489 PRLKT----SLDGNIGSIIQFSYDGLCDEDKYLLLYIACLFNYESTTKVE 534  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                   + La++ +LDV+qGL+vLa+KSLI+i++++ +    +ti MH+LL+q+GR
  gi|1135725   535 EVLANK-FLDVKQGLHVLAQKSLISIDENSLY---GDTINMHTLLRQFGR 580  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtse
                   e   rkQ ++ +   KRq Lv  ++Ic+VL+d+T ++ r+++GI +D+ +
  gi|1135725   581 E-TSRKQFVY-HGFTKRQLLVGERDICEVLSDDTIDS-RRFIGITFDLFG 627  

                   ieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   +++ lnIsekA+e+M ++ F ri+    + ++    
  gi|1135725   628 TQDYLNISEKALERMNDFEFVRINAL--IPTER    658  

gi|10177586|dbj|BAB10817.1|: domain 1 of 1, from 177 to 571: score 834.6, E = 4.2e-246
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      +DFdd+VG+E+H+++m+ LL+L+sk eV+MVGIwG++GIGKTTIARA
  gi|1017758   177    KDFDDFVGLEDHIANMSALLDLESK-EVKMVGIWGSSGIGKTTIARA 222  

                   LfsqLSerhFq.ssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGm
                   Lf+ L+ rhFq ++F+++ F +++r      ei+S+    a++D+++  m
  gi|1017758   223 LFNNLF-RHFQvRKFIDRSFAYKSR------EIHSS----ANPDDHN--M 259  

                   KLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLd
                   KLhLQe fLS+IL++ +ikI+ +  ++eERLk qKVLIi+DD+Dd+++Ld
  gi|1017758   260 KLHLQESFLSEILRMPNIKID-DPTALEERLKYQKVLIIIDDLDDIMVLD 308  

                   ALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFC
                   +L+++tqWFG+GSRIIV+T+Dk++L aHgI+h IYeV+fP++ +A+q++C
  gi|1017758   309 TLVGQTQWFGYGSRIIVVTNDKHFLTAHGIDH-IYEVSFPTDVHACQMLC 357  

                   rsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedm
                   +sAF+Qn +p+GF +L ++ V+++a ++PLGL+ lG +LRG+++e+W+d+
  gi|1017758   358 QSAFKQNYAPEGFGDL-VVDVVRHACSFPLGLNLLGKYLRGRNEEYWMDI 406  

                   LpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyV
                   LpRL++  g +LDgkIek+Lr+sYDgL+++Dq++F+hIAC+F ++kv+++
  gi|1017758   407 LPRLEN--GLRLDGKIEKILRISYDGLDSEDQEIFRHIACIFIHMKVTTI 454  

                   kalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLG
                   k+lLa+s   DV++ L++LadKSLIh++        +g+++MH+ Lq++G
  gi|1017758   455 KSLLAES---DVSFALENLADKSLIHVR--------QGYVVMHRSLQEMG 493  

                   ReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDts
                   R+ IVr Qsid  +Pg+R+FLvD+++I+dVL+ +TGt+  +VlGIsl+t+
  gi|1017758   494 RK-IVRIQSID--NPGEREFLVDPNDIHDVLNACTGTQ--KVLGISLNTR 538  

                   eieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   +i  el+++e+A +gM+NL+FL+i++ ++++++    
  gi|1017758   539 NIV-ELDVHESAIKGMSNLRFLEIKDFISQWKKA    571  

gi|3860167|gb|AAC72979.1|: domain 1 of 1, from 250 to 643: score 829.7, E = 1.3e-244
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      rDFd+lVG++aH+ +m+ LL+Ld  deVr++GIwGP+GIGKTTIAR+
  gi|3860167   250    RDFDGLVGMRAHMNMMEHLLRLDL-DEVRIIGIWGPPGIGKTTIARF 295  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L +q S     ++Fqlsa+m n++g+y         +rp ++DeYs  ++
  gi|3860167   296 LLNQVS-----DRFQLSAIMVNIKGCY---------PRP-CFDEYS--AQ 328  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   L+LQ+q+LS+++n+kDi+I+ HLGv++ERL+d+KV+++LD VD+l QLdA
  gi|3860167   329 LQLQNQMLSQMINHKDIMIS-HLGVAQERLRDKKVFLVLDEVDQLGQLDA 377  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   LAket+WFGpGSRII+TTeD   LkaHgInh +Y+Vg+PS++eA+qIFC+
  gi|3860167   378 LAKETRWFGPGSRIIITTEDLGVLKAHGINH-VYKVGYPSNDEAFQIFCM 426  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                    AFgQ++P++GF e+ AreV  LaG+LPLGL VlGS+LRGksk eWe++L
  gi|3860167   427 NAFGQKQPHEGFDEI-AREVMALAGELPLGLTVLGSALRGKSKPEWERTL 475  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                   pRL+t    sLDg+I ++ ++sYD+L+++D++LFL+IAC+FN e  ++Vk
  gi|3860167   476 PRLKT----SLDGNIGSIIQFSYDALCDEDKYLFLYIACLFNDESTTKVK 521  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                   +lL++  +LDV+qGL+vLa+KSLI+ s l+ +    ++i MH+LL+q+GR
  gi|3860167   522 ELLGK--FLDVKQGLHVLAQKSLISLSYLTFY---GERIHMHTLLEQFGR 566  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtse
                   e   rkQ + h+   KRq Lv a+ Ic+VL+d+T ++ r+++GI+l++s+
  gi|3860167   567 E-TSRKQFV-HHGFTKRQLLVGARGICEVLDDDTTDS-RRFIGINLELSN 613  

                   ieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   +eeelnIsek++e+ +++ F ri+ +   ++++   
  gi|3860167   614 TEEELNISEKVLERVHDFHFVRIDAS---FQPE    643  

gi|11357251|pir||T47438: domain 1 of 1, from 263 to 680: score 828.8, E = 2.3e-244
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      rDFd+lVG++aH+ ++++LL+Ld  deVr++GIwGP+GIGKTTIAR+
  gi|1135725   263    RDFDGLVGMRAHMDMLEQLLRLDL-DEVRIIGIWGPPGIGKTTIARF 308  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L +q S     ++Fqlsa+m n++g+y         +rp ++DeYs  ++
  gi|1135725   309 LLNQVS-----DRFQLSAIMVNIKGCY---------PRP-CFDEYS--AQ 341  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   L+LQ+q+LS+++n+kDi+I+ HLGv++ERL+d+KV+++LD VD+l QLdA
  gi|1135725   342 LQLQNQMLSQMINHKDIMIS-HLGVAQERLRDKKVFLVLDEVDQLGQLDA 390  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   LAket+WFGpGSRII+TTeD   LkaHgInh +Y+V++PS++eA+qIFC+
  gi|1135725   391 LAKETRWFGPGSRIIITTEDLGVLKAHGINH-VYKVEYPSNDEAFQIFCM 439  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                    AFgQ++P++GF e+ A+eV  LaG+LPLGL+VlGS+LRGksk eWe++L
  gi|1135725   440 NAFGQKQPHEGFDEI-AWEVKALAGKLPLGLKVLGSALRGKSKPEWERTL 488  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                   pRLrt    sLDgkI  + ++sYD+L+++D++LFL+IAC+FNge  ++Vk
  gi|1135725   489 PRLRT----SLDGKIGGIIQFSYDALCDEDKYLFLYIACLFNGESTTKVK 534  

                   alLadsnnLDVrqGLkvLadKSLIhisplgne..................
                   +lL++  +LDVrqGL+vLa+KSLI+++++  +++  +    ++ ++ +++
  gi|1135725   535 ELLGK--FLDVRQGLHVLAQKSLISFDEEISWkqivqvlllnkfshvrht 582  

                   ..dkvdgtieMHnLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVL
                   +++k  ++i+MH+LL+q+GRe   rkQ + h+ + K+q Lv  ++Ic+VL
  gi|1135725   583 krNK-SQIIRMHTLLEQFGRE-TSRKQFV-HHRYTKHQLLVGERDICEVL 629  

                   tdnTGtgtrsVlGIslDtseieeelnIsekAFegMrNLqFLriykksfrd
                   +d+T +  r+++GI+lD++++eeelnIsekA+e+++++qF +i+   f +
  gi|1135725   630 DDDTTDN-RRFIGINLDLYKNEEELNISEKALERIHDFQFVKINY-VFTH 677  

                   dgk<-*
                   +++   
  gi|1135725   678 QPE    680  

gi|12324936|gb|AAG52415.1|AC011622_3: domain 1 of 1, from 186 to 572: score 822.6, E = 1.8e-242
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      +DF+d+ G+EaHl+k++sLL+Ld+kde+ ++GI+GPaGIGK+TIARA
  gi|1232493   186    KDFEDMMGLEAHLKKIQSLLRLDYKDEALIIGISGPAGIGKSTIARA 232  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L s+LS     ++Fql++Fm+ lr        gS    ++gl++Y+   +
  gi|1232493   233 LESRLS-----DRFQLTCFMD-LR--------GS---ENNGLHDYG--QQ 263  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   L+LQeq+L+k+Lnq++ +I+ HLGv+++RL d +VLIiLDDV d++QL+A
  gi|1232493   264 LRLQEQLLAKVLNQDGTRIC-HLGVLQQRLSDLRVLIILDDVSDIKQLKA 312  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   LAket+WFGpGSRIIVTTe+k LL++ gI+ t Y+VgfPS+eeAL+IFC 
  gi|1232493   313 LAKETTWFGPGSRIIVTTENKDLLQQRGIDST-YHVGFPSREEALEIFCK 361  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                    AF Q+sPp+ Fe+L A ++t+L+GnLPLGL+V+GSsL Gk+++eWe + 
  gi|1232493   362 FAFEQSSPPHAFEKL-AARITHLCGNLPLGLCVMGSSLFGKKQDEWEFVV 410  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                   +RL+t       ++I++vLrv+Y++Lhe+Dq LFLhIA+fFN++++d+V+
  gi|1232493   411 HRLET----NPGQEIDDVLRVGYERLHENDQMLFLHIAIFFNYRDRDLVE 456  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                   a+Lad++nLDV ++Lk L +KSLI i ++g+       i+MH+LLqq+GR
  gi|1232493   457 AMLADDGNLDVGNWLKFLINKSLIEIYRTGQ-------IVMHKLLQQVGR 499  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtse
                   +A +r+Q+     P+KRq+L++a+eIcd L +++Gt++ +V+GIs+Dts+
  gi|1232493   500 QA-IRRQE-----PWKRQILINANEICDLLRYEKGTSC-NVSGISFDTSG 542  

                   ieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   i+ e+ I + AF+++++L+FL++yk+  rddg+   
  gi|1232493   543 IS-EVTICDGAFKRLHDLRFLHVYKS--RDDGN    572  

gi|5302807|emb|CAB46048.1|: domain 1 of 1, from 183 to 565: score 821.1, E = 4.8e-242
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      ++Fdd+VGiEaH+e++ks LcL+sk e+rMVGIwG++GIGK+TI+RA
  gi|5302807   183    KCFDDFVGIEAHIEAIKSVLCLESK-EARMVGIWGQSGIGKSTIGRA 228  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   LfsqLS      +F l+aF +++++              +g+D  +  mK
  gi|5302807   229 LFSQLS-----IQFPLRAFLTYKST--------------SGSDVSG--MK 257  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   L++++++LS+IL+qkDikI+ H+Gv+e+RLk++KVLI LDDVD+le+L++
  gi|5302807   258 LSWEKELLSEILGQKDIKIE-HFGVVEQRLKHKKVLILLDDVDNLEFLKT 306  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   L+++++WFG+GSRIIV+T+D+q+LkaH+I++ +YeV++PS+++AL+++Cr
  gi|5302807   307 LVGKAEWFGSGSRIIVITQDRQFLKAHDIDL-VYEVKLPSQGLALTMLCR 355  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   sAFg++sPpd+F+eL A+eV+kLaG+LPLGL+VlGSsLR++ k+eW++m+
  gi|5302807   356 SAFGKDSPPDDFKEL-AFEVAKLAGHLPLGLNVLGSSLRRRGKKEWMEMM 404  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                   pRLr+    +L+g+I+k+LrvsYD+Lh+kDq++FL+IAC+FNg++v+yVk
  gi|5302807   405 PRLRN----GLNGDIMKTLRVSYDRLHQKDQDMFLCIACLFNGFEVSYVK 450  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                   +lL+d+      +GL++L +KSLI+i+p       dg+ieMHnLL++LGR
  gi|5302807   451 DLLEDN------VGLTMLSEKSLIRITP-------DGHIEMHNLLEKLGR 487  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslD..t
                   e I+r++s++  +PgKRqFL+++e+I++V t++TGt+  + lGI+l  + 
  gi|5302807   488 E-IDRAKSKG--NPGKRQFLTNFEDIHEVVTEKTGTE--TLLGIRLPfeE 532  

                   seieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   +   + l I++++F+gMrNLq+L+i ++  +d g+   
  gi|5302807   533 YFSTRPLLIDKESFKGMRNLQYLKIGDW--SDGGQ    565  

gi|5302803|emb|CAB46044.1|: domain 1 of 1, from 178 to 561: score 813.4, E = 1e-239
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                       DF+dlVGiE H+e++ks LcL+sk+++ MVGIwG++GIGK+TI+RA
  gi|5302803   178    DDFGDLVGIENHIEAIKSVLCLESKEARIMVGIWGQSGIGKSTIGRA 224  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L+s+LS      +F+++aF++++++              +g+D  +  mK
  gi|5302803   225 LYSKLS-----IQFHHRAFITYKST--------------SGSDVSG--MK 253  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   L++++++LS+IL+qkDikI+ H+Gv+e+RLk+qKVLI LDDVD le+L++
  gi|5302803   254 LRWEKELLSEILGQKDIKIE-HFGVVEQRLKQQKVLILLDDVDSLEFLKT 302  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   L+++++WFG+GSRIIV+T+D+qLLkaH+I++ IYeV+fPS+++AL+++Cr
  gi|5302803   303 LVGKAEWFGSGSRIIVITQDRQLLKAHEIDL-IYEVEFPSEHLALTMLCR 351  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   sAFg++sPpd+F+eL A+eV+kLaGnLPLGL+VlGSsL+G++ke W++m+
  gi|5302803   352 SAFGKDSPPDDFKEL-AFEVAKLAGNLPLGLSVLGSSLKGRTKEWWMEMM 400  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                   pRLr+    +L+g+I+k+LrvsYD+Lh+kDq++FL+IAC+FNg++v+yVk
  gi|5302803   401 PRLRN----GLNGDIMKTLRVSYDRLHQKDQDMFLYIACLFNGFEVSYVK 446  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                   +lL d+      +G+++L++KSLI+i+p       dg+ieMHnLL++LGR
  gi|5302803   447 DLLKDN------VGFTMLTEKSLIRITP-------DGYIEMHNLLEKLGR 483  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslD..t
                   e I+r++s++  +PgKR+FL+++e+I++V t++TGt+  + lGI+l  + 
  gi|5302803   484 E-IDRAKSKG--NPGKRRFLTNFEDIHEVVTEKTGTE--TLLGIRLPfeE 528  

                   seieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   +   + l I++++F+gMrNLq+L+i     +d ++   
  gi|5302803   529 YFSTRPLLIDKESFKGMRNLQYLEIGYY--GDLPQ    561  

gi|7485210|pir||H71436: domain 1 of 1, from 178 to 561: score 813.4, E = 1e-239
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                       DF+dlVGiE H+e++ks LcL+sk+++ MVGIwG++GIGK+TI+RA
  gi|7485210   178    DDFGDLVGIENHIEAIKSVLCLESKEARIMVGIWGQSGIGKSTIGRA 224  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L+s+LS      +F+++aF++++++              +g+D  +  mK
  gi|7485210   225 LYSKLS-----IQFHHRAFITYKST--------------SGSDVSG--MK 253  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   L++++++LS+IL+qkDikI+ H+Gv+e+RLk+qKVLI LDDVD le+L++
  gi|7485210   254 LRWEKELLSEILGQKDIKIE-HFGVVEQRLKQQKVLILLDDVDSLEFLKT 302  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   L+++++WFG+GSRIIV+T+D+qLLkaH+I++ IYeV+fPS+++AL+++Cr
  gi|7485210   303 LVGKAEWFGSGSRIIVITQDRQLLKAHEIDL-IYEVEFPSEHLALTMLCR 351  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   sAFg++sPpd+F+eL A+eV+kLaGnLPLGL+VlGSsL+G++ke W++m+
  gi|7485210   352 SAFGKDSPPDDFKEL-AFEVAKLAGNLPLGLSVLGSSLKGRTKEWWMEMM 400  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                   pRLr+    +L+g+I+k+LrvsYD+Lh+kDq++FL+IAC+FNg++v+yVk
  gi|7485210   401 PRLRN----GLNGDIMKTLRVSYDRLHQKDQDMFLYIACLFNGFEVSYVK 446  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                   +lL d+      +G+++L++KSLI+i+p       dg+ieMHnLL++LGR
  gi|7485210   447 DLLKDN------VGFTMLTEKSLIRITP-------DGYIEMHNLLEKLGR 483  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslD..t
                   e I+r++s++  +PgKR+FL+++e+I++V t++TGt+  + lGI+l  + 
  gi|7485210   484 E-IDRAKSKG--NPGKRRFLTNFEDIHEVVTEKTGTE--TLLGIRLPfeE 528  

                   seieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   +   + l I++++F+gMrNLq+L+i     +d ++   
  gi|7485210   529 YFSTRPLLIDKESFKGMRNLQYLEIGYY--GDLPQ    561  

gi|11357260|pir||T47430: domain 1 of 1, from 208 to 599: score 812.9, E = 1.5e-239
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      +DFdd+VG+ aH+e+ ++LL+Ld  deVrM+GI GP+GIGKTTIA  
  gi|1135726   208    KDFDDFVGMAAHMERTEQLLRLDL-DEVRMIGILGPPGIGKTTIATC 253  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   +f+++S     ++F + a+m+ +r++y         +r  +l+e++  ++
  gi|1135726   254 MFDRFS-----RRFPFAAIMTDIRECY---------PRL-CLNERN--AQ 286  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   L LQeq+LS+I+nqkD +I+ HLGv++ERLkd+KV+++LD V +l QLdA
  gi|1135726   287 LKLQEQMLSQIFNQKDTMIS-HLGVAPERLKDKKVFLVLDEVGHLGQLDA 335  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   LAket+WFGpGSRII+TTeD   LkaHgInh +Y+Vg+PS++eA+qIFC+
  gi|1135726   336 LAKETRWFGPGSRIIITTEDLGVLKAHGINH-VYKVGYPSNDEAFQIFCM 384  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                    AFgQ++P +GF +L A+eV  LaG+LPLGL+VlGS+LRG+sk eWe++L
  gi|1135726   385 NAFGQKQPCEGFCDL-AWEVKALAGELPLGLKVLGSALRGMSKPEWERTL 433  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                   pRLrt    sLDgkI ++ ++sYD+L+++D++LFL+IAC+FN+e  ++Vk
  gi|1135726   434 PRLRT----SLDGKIGNIIQFSYDALCDEDKYLFLYIACLFNYESTTKVK 479  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                   +lL++  +LDV+qGL+vLa+KSLI++          +ti+MH+LL+q+GR
  gi|1135726   480 ELLGK--FLDVKQGLHVLAQKSLISFY--------GETIRMHTLLEQFGR 519  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtse
                   e   +kQ + h+ ++K+q Lv  ++Ic+VL+d+T +  r+++GI+lD+++
  gi|1135726   520 E-TSCKQFV-HHGYRKHQLLVGERDICEVLDDDTRDN-RRFIGINLDLRK 566  

                   ieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   +e+el Isek +e+M+++qF ri++  + ++ +   
  gi|1135726   567 NEKELKISEKTLERMHDFQFVRINDVFTHKERQ    599  

gi|12323031|gb|AAG51508.1|AC058785_11: domain 1 of 1, from 181 to 566: score 808.3, E = 3.5e-238
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      rDFdd+VG+E Hl++m sLL+Ld  ++V+MVGI+GPaGIGK+TIA+A
  gi|1232303   181    RDFDDMVGLERHLKEMVSLLDLDK-EGVKMVGISGPAGIGKSTIAKA 226  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L+s++S     s Fq+++F++nl+++y+           ++  e++  +K
  gi|1232303   227 LHSRHS-----STFQHNCFVDNLWENYK-----------ICTGEHG--VK 258  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   L+L+eqf SkIL+q++++   HL vi++RL+d+KVLIiLDDV+ l QL++
  gi|1232303   259 LRLHEQFVSKILKQNGLELT-HLSVIKDRLQDKKVLIILDDVESLAQLET 307  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   LA+ ++WFGpGSR+IVTTe+k++L++HgI + IY+Vg+PS+ eAL+IFC+
  gi|1232303   308 LAD-MTWFGPGSRVIVTTENKEILQQHGIGD-IYQVGYPSESEALTIFCL 355  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   sAF+Q sPpdGF++L A eV++++++LPL+L+VlGSsL +ks+ +Wed+L
  gi|1232303   356 SAFKQASPPDGFMDL-ADEVVRICDKLPLALCVLGSSLLRKSQTDWEDEL 404  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                   pRLr+    +LDg Ie+vL+v++++L+ekDqaLFL+I +fFN+e +d+V+
  gi|1232303   405 PRLRN----CLDG-IESVLKVGFESLNEKDQALFLYITVFFNYECADHVT 449  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                    +La+s nL+Vr+GLk+La++ LIhi+  +++   +++++ H+LL+ ++ 
  gi|1232303   450 LMLAKS-NLNVRLGLKNLANRYLIHID--HDQ---KKRVVVHRLLRVMAI 493  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtse
                   + ++ kQ+     P+K q+LvDae I +VL+++TG++  s+ G s+Dt e
  gi|1232303   494 Q-VCTKQK-----PWKSQILVDAEKIAYVLEEATGNR--SIKGVSFDTAE 535  

                   ieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   i+ el+Is kAFe+M+NL+FL++y+   +++gk   
  gi|1232303   536 ID-ELMISPKAFEKMCNLLFLKVYDA-GWHTGK    566  

gi|6449046|gb|AAF08790.1|: domain 1 of 1, from 183 to 567: score 801.8, E = 3.3e-236
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      ++Fdd+VGiEaH+e++ks LcL+sk e+rMVGIwG++GIGK+TI+RA
  gi|6449046   183    KCFDDFVGIEAHIEAIKSVLCLESK-EARMVGIWGQSGIGKSTIGRA 228  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   LfsqLS     s+F+++aF +++++              +g+D  +  mK
  gi|6449046   229 LFSQLS-----SQFHHRAFLTYKST--------------SGSDVSG--MK 257  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   L++Q+++LS+IL+qkDikI+ H+Gv+e+RL+++KVLI LDDVD+le+L++
  gi|6449046   258 LSWQKELLSEILGQKDIKIE-HFGVVEQRLNHKKVLILLDDVDNLEFLKT 306  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   L+++++WFG+GSRIIV+T+D+qLLkaH+I++ +YeV++PS+++AL++  +
  gi|6449046   307 LVGKAEWFGSGSRIIVITQDRQLLKAHEIDL-VYEVKLPSQGLALKMISQ 355  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   +AFg++sPpd+F+eL A+eV++L+G+LPLGL+VlGSsL+G++k+eW++m+
  gi|6449046   356 YAFGKDSPPDDFKEL-AFEVAELVGSLPLGLSVLGSSLKGRDKDEWVKMM 404  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                   pRLr+      D+kIe++Lrv+YD+L++k+ +LF +IACfFNg+kv++Vk
  gi|6449046   405 PRLRN----DSDDKIEETLRVGYDRLNKKNRELFKCIACFFNGFKVSNVK 450  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                   +lL+d+      +GL++La+ SLI+i+p        g+ieMHnLL++LGR
  gi|6449046   451 ELLEDD------VGLTMLAEESLIRITP-------VGYIEMHNLLEKLGR 487  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslD..t
                   e I+r++s++  +PgKRqFL+++e+I++VLt++TGt+  + lGI+l ++ 
  gi|6449046   488 E-IDRAKSKG--NPGKRQFLTNFEDIREVLTEKTGTE--TLLGIRLPhpG 532  

                   seieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   + + + + I+ek+F+gMrNLq+L+i  +s++  ++   
  gi|6449046   533 YLTTRSFLIDEKSFKGMRNLQYLEIGYWSDGVLPQ    567  

gi|12597786|gb|AAG60098.1|AC073178_9: domain 1 of 1, from 247 to 637: score 801.5, E = 3.9e-236
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                        F++l+G++aH+ekmk+LLcLds de+r VGI+GP+GIGK+TIAR+
  gi|1259778   247    SGFEGLIGMKAHIEKMKQLLCLDSTDERRTVGISGPSGIGKSTIARV 293  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L++q+S     + Fq+s+Fm   + sy         trp+++D+++  +K
  gi|1259778   294 LHNQIS-----DGFQMSVFMK-FKPSY---------TRPICSDDHD--VK 326  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   L+L++qfL++++nq+DikIh +LG++++  + +KVLI+LD+VD+l+QL A
  gi|1259778   327 LQLEQQFLAQLINQEDIKIH-QLGTAQNFVMGKKVLIVLDGVDQLVQLLA 375  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   + k + + GpGSRII+TT+D+qLLka+ I+h IY V+fP ++eALqIFC 
  gi|1259778   376 MPK-AVCLGPGSRIIITTQDQQLLKAFQIKH-IYNVDFPPDHEALQIFCI 423  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   +AFg++sP dGFe+L A +Vt+LaGnLPLGLrV+GS++RG+ske+W+ +L
  gi|1259778   424 HAFGHDSPDDGFEKL-ATKVTRLAGNLPLGLRVMGSHFRGMSKEDWKGEL 472  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFN.gekvdyV
                   pRLr     +LDg+I ++L++sYD L+++D++LFLhIACfFN++ ++++ 
  gi|1259778   473 PRLRI----RLDGEIGSILKFSYDVLDDEDKDLFLHIACFFNdEGIDHTF 518  

                   kalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLG
                   ++ L ++ + +V+ GL+vL+++SLI+ ++l        t  MHnLL+qLG
  gi|1259778   519 EDTLRHK-FSNVQRGLQVLVQRSLIS-EDL--------TQPMHNLLVQLG 558  

                   ReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslD.t
                   Re IVr+Qs+  +ePgKRqFLvD +eIc+VLt +TG++  sV+GI+++  
  gi|1259778   559 RE-IVRNQSV--YEPGKRQFLVDGKEICEVLTSHTGSE--SVIGINFEvY 603  

                   seieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   + ++ elnIs+++FegM+NLqF r++++s+++      
  gi|1259778   604 WSMD-ELNISDRVFEGMSNLQFFRFDENSYGRLHL    637  

gi|14532598|gb|AAK64027.1|: domain 1 of 1, from 249 to 639: score 801.5, E = 3.9e-236
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                        F++l+G++aH+ekmk+LLcLds de+r VGI+GP+GIGK+TIAR+
  gi|1453259   249    SGFEGLIGMKAHIEKMKQLLCLDSTDERRTVGISGPSGIGKSTIARV 295  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L++q+S     + Fq+s+Fm   + sy         trp+++D+++  +K
  gi|1453259   296 LHNQIS-----DGFQMSVFMK-FKPSY---------TRPICSDDHD--VK 328  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   L+L++qfL++++nq+DikIh +LG++++  + +KVLI+LD+VD+l+QL A
  gi|1453259   329 LQLEQQFLAQLINQEDIKIH-QLGTAQNFVMGKKVLIVLDGVDQLVQLLA 377  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   + k + + GpGSRII+TT+D+qLLka+ I+h IY V+fP ++eALqIFC 
  gi|1453259   378 MPK-AVCLGPGSRIIITTQDQQLLKAFQIKH-IYNVDFPPDHEALQIFCI 425  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   +AFg++sP dGFe+L A +Vt+LaGnLPLGLrV+GS++RG+ske+W+ +L
  gi|1453259   426 HAFGHDSPDDGFEKL-ATKVTRLAGNLPLGLRVMGSHFRGMSKEDWKGEL 474  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFN.gekvdyV
                   pRLr     +LDg+I ++L++sYD L+++D++LFLhIACfFN++ ++++ 
  gi|1453259   475 PRLRI----RLDGEIGSILKFSYDVLDDEDKDLFLHIACFFNdEGIDHTF 520  

                   kalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLG
                   ++ L ++ + +V+ GL+vL+++SLI+ ++l        t  MHnLL+qLG
  gi|1453259   521 EDTLRHK-FSNVQRGLQVLVQRSLIS-EDL--------TQPMHNLLVQLG 560  

                   ReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslD.t
                   Re IVr+Qs+  +ePgKRqFLvD +eIc+VLt +TG++  sV+GI+++  
  gi|1453259   561 RE-IVRNQSV--YEPGKRQFLVDGKEICEVLTSHTGSE--SVIGINFEvY 605  

                   seieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   + ++ elnIs+++FegM+NLqF r++++s+++      
  gi|1453259   606 WSMD-ELNISDRVFEGMSNLQFFRFDENSYGRLHL    639  

gi|7488168|pir||C71436: domain 1 of 1, from 180 to 566: score 800.1, E = 1e-235
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      + F+d+VGiE+H++++ks+LcL+sk+++ MVGIwG++GIGK+TI+RA
  gi|7488168   180    KGFGDFVGIEDHIKAIKSILCLESKEARIMVGIWGQSGIGKSTIGRA 226  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   LfsqLS     s+F+++aF++++++              +g+D  +  mK
  gi|7488168   227 LFSQLS-----SQFHHRAFITYKST--------------SGSDVSG--MK 255  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   L++++++LS+IL+qkDikI+ H+Gv+e+RLk++KVLI LDDVD+le+L++
  gi|7488168   256 LSWEKELLSEILGQKDIKID-HFGVVEQRLKHKKVLILLDDVDNLEFLKT 304  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   L+++++WFG+GSRIIV+T+DkqLLkaH+I++ +YeV++PS+++AL++  +
  gi|7488168   305 LVGKAEWFGSGSRIIVITQDKQLLKAHEIDL-VYEVELPSQGLALKMISQ 353  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   +AFg++sPpd+F+eL A+eV++L+G+LPLGL+VlGSsL+G++k+eW++m+
  gi|7488168   354 YAFGKDSPPDDFKEL-AFEVAELVGSLPLGLSVLGSSLKGRDKDEWVKMM 402  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                   pRLr+      D+kIe++Lrv+YD+L++k+ +LF +IACfFNg+kv++Vk
  gi|7488168   403 PRLRN----DSDDKIEETLRVGYDRLNKKNRELFKCIACFFNGFKVSNVK 448  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                   +lL+d+      +GL++LadKSLI+i+p       dg ieMHnLL++LGR
  gi|7488168   449 ELLEDD------VGLTMLADKSLIRITP-------DGDIEMHNLLEKLGR 485  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslD..t
                   e I+r++s++  +P KRqFL+++e+I +V t++TGt+  +VlGI+  +++
  gi|7488168   486 E-IDRAKSKG--NPAKRQFLTNFEDIQEVVTEKTGTE--TVLGIRVPptV 530  

                   seiee.elnIsekAFegMrNLqFLriykksfrddgk<-*
                       ++ l+I+e++F+gMrNLq+L+i  +s++d ++   
  gi|7488168   531 LFSTRpLLVINEESFKGMRNLQYLEIGHWSEIDLPQ    566  

gi|5302806|emb|CAB46047.1|: domain 1 of 1, from 175 to 565: score 798.3, E = 3.5e-235
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      + F+dlVGiE+H+e++k+ LcL+sk+++ MVGIwG++GIGK+TI+RA
  gi|5302806   175    KGFGDLVGIEDHIEAIKLKLCLESKEARIMVGIWGQSGIGKSTIGRA 221  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   LfsqLS     s+F+++aF++++++              +g+D  +  mK
  gi|5302806   222 LFSQLS-----SQFHHRAFITYKST--------------SGSDVSG--MK 250  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   L++++++LS+IL+qkDikI+ H+Gv+e+RLk++KVLI LDDVD+le+L +
  gi|5302806   251 LSWEKELLSEILGQKDIKIE-HFGVVEQRLKHKKVLILLDDVDNLEFLRT 299  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   L+++++WFG+GSRIIV+T+D+qLLkaH+I++ IYeV++PS+++AL++ C+
  gi|5302806   300 LVGKAEWFGSGSRIIVITQDRQLLKAHEIDL-IYEVKLPSQGLALKMICQ 348  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   +AFg+ sPpd+F+eL A+eV+kLaGnLPLGL+VlGSsL+++skeeW++mL
  gi|5302806   349 YAFGKYSPPDDFKEL-AFEVAKLAGNLPLGLSVLGSSLKRRSKEEWMEML 397  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                    +L++    +L+++I+k+LrvsY +L+ kDq++F +IA++FNg kv+ +k
  gi|5302806   398 AELQN----GLNRDIMKTLRVSYVRLDPKDQDIFHYIAWLFNGWKVKSIK 443  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                   ++L+d   ++V+++Lk+L dKSLI+ +p       ++tieMHnLLq+L+ 
  gi|5302806   444 DFLGD--GVNVNIRLKTLDDKSLIRLTP-------NDTIEMHNLLQKLAT 484  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslD...
                   e I+r++s++  +PgKR+FL +aeeI dV+tdnTGt+  + lGI++ +++
  gi|5302806   485 E-IDREESNG--NPGKRRFLENAEEILDVFTDNTGTE--KLLGIDFStss 529  

                   tseiee.elnIsekAFegMrNLqFLriykksfrddgk<-*
                    s i+++ ++I+e++F+gM NLqFL+i++++ ++++    
  gi|5302806   530 DSQIDKpFISIDENSFQGMLNLQFLNIHDHY-WWQPR    565  

gi|7488173|pir||G71437: domain 1 of 1, from 182 to 572: score 796.6, E = 1.1e-234
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      + F+dlVGiE+H+e++k+ LcL+sk+++ MVGIwG++GIGK+TI+RA
  gi|7488173   182    KGFGDLVGIEDHIEAIKLKLCLESKEARIMVGIWGQSGIGKSTIGRA 228  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   LfsqLS     s+F+++aF++++++              +g+D  +  mK
  gi|7488173   229 LFSQLS-----SQFHHRAFITYKST--------------SGSDVSG--MK 257  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   L++++++LS+IL+qkDikI+ H+Gv+e+RLk++KVLI LDDVD+le+L +
  gi|7488173   258 LSWEKELLSEILGQKDIKIE-HFGVVEQRLKHKKVLILLDDVDNLEFLRT 306  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   L+++++WFG+GSRIIV+T+D+qLLkaH+I++ IYeV++PS+++AL++ C+
  gi|7488173   307 LVGKAEWFGSGSRIIVITQDRQLLKAHEIDL-IYEVKLPSQGLALKMICQ 355  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   +AFg+ sPpd+F+eL A+eV+kLaGnLPLGL+VlGSsL+++skeeW++mL
  gi|7488173   356 YAFGKYSPPDDFKEL-AFEVAKLAGNLPLGLSVLGSSLKRRSKEEWMEML 404  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                    +L++    +L+++I+k+LrvsY +L+ kDq++F +IA++FNg kv+ +k
  gi|7488173   405 AELQN----GLNRDIMKTLRVSYVRLDPKDQDIFHYIAWLFNGWKVKSIK 450  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                   ++L+d   ++V+++Lk+L dKSLI+ +p       ++tieMHnLLq+L+ 
  gi|7488173   451 DFLGD--GVNVNIRLKTLDDKSLIRLTP-------NDTIEMHNLLQKLAT 491  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslD...
                   e I+r++s++  +PgKR+FL +aeeI dV+tdnTGt+  + lGI++  ++
  gi|7488173   492 E-IDREESNG--NPGKRRFLENAEEILDVFTDNTGTE--KLLGIHFSass 536  

                   tseiee.elnIsekAFegMrNLqFLriykksfrddgk<-*
                    s i+++ ++I+e++F+gM NLq+L+i+++s ++++    
  gi|7488173   537 DSQIDKpFISIDENSFQGMLNLQYLKIHDHS-WWQPR    572  

gi|5302805|emb|CAB46046.1|: domain 1 of 1, from 176 to 561: score 794.3, E = 5.7e-234
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      + F+dlVGiE+H+e++ks+LcL+sk++  MVGIwG++GIGK+TI+RA
  gi|5302805   176    KGFGDLVGIEDHIEAIKSILCLESKEAKIMVGIWGQSGIGKSTIGRA 222  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   LfsqLS     s+F l+aF++++++              +g+D  +  mK
  gi|5302805   223 LFSQLS-----SQFPLRAFVTYKST--------------SGSDVSG--MK 251  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   L++Q+++LS+IL+qkDikI+ H+Gv+e+RLk++KVLI LDDVD+le+L++
  gi|5302805   252 LSWQKELLSEILGQKDIKID-HFGVVEQRLKHKKVLILLDDVDNLEFLKT 300  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   L+++++WFG+GSRIIV+T+D+qLLkaH+I++ +YeV++PS+++ALq+  +
  gi|5302805   301 LVGKAEWFGSGSRIIVITQDRQLLKAHEIDL-VYEVKLPSQGLALQMISQ 349  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   +AFg++sPpd+F+ L A+eV++LaG+LPLGL+VlGSsL+G++k+eW++m+
  gi|5302805   350 YAFGKDSPPDDFKAL-AFEVAELAGSLPLGLSVLGSSLKGRDKDEWVKMM 398  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                   pRLr+      D+kIe++Lrv+YD+L++k+ +LF +IACfFNg+kv++Vk
  gi|5302805   399 PRLRN----DSDDKIEETLRVCYDRLNKKNRELFKCIACFFNGFKVSNVK 444  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                   +lL+d+      +GL++L++KSLI+i+p       dg ieMHnLL++LGR
  gi|5302805   445 ELLEDD------VGLTMLVEKSLIRITP-------DGDIEMHNLLEKLGR 481  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslD..t
                   e I+r++s++  +PgKRqFL+++e+I +VL+++TGt+    lGI+l ++ 
  gi|5302805   482 E-IDRAKSKG--NPGKRQFLTNFEDIQEVLAEKTGTE--ILLGIRLPhpG 526  

                   seieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   + + + + I+ek F+gMrNLq+L+i  +s++d ++   
  gi|5302805   527 YLTTRSFLIDEKLFKGMRNLQYLEIGYWSDGDLPQ    561  

gi|9954759|gb|AAG09110.1|AC009323_21: domain 1 of 1, from 181 to 571: score 791.4, E = 4.4e-233
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      rDFd++VG+ +Hl++m+sLL+L++ d+V++VGI+GPaGIGK+TIA A
  gi|9954759   181    RDFDGMVGLNDHLREMESLLDLKN-DGVKIVGISGPAGIGKSTIATA 226  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L+ +LS     + Fq ++F++nlr           e++++glDeY   +K
  gi|9954759   227 LHGRLS-----NMFQRTCFVDNLR-----------ESYKIGLDEYR--LK 258  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   LhLQ+q+L+ +Lnq+ i++  HL v++ERL d +VLIiLDDV++l QL+A
  gi|9954759   259 LHLQQQLLAYVLNQDKIRVG-HLSVMKERLDDLRVLIILDDVEHLYQLEA 307  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   LA+ ++WFGpGSR+IVTTe++++L +HgI++ IY+VgfPS++eAL+IFC+
  gi|9954759   308 LAD-IRWFGPGSRVIVTTENREILLQHGIKD-IYHVGFPSEGEALMIFCL 355  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   sAF+Q sPp+GF +L ++eV+ ++GnLPLGL+VlG  L+Gks+ +W+++L
  gi|9954759   356 SAFRQPSPPYGFLKL-TYEVASICGNLPLGLHVLGTLLWGKSQADWIEEL 404  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                   pRL+     +LDg+Ie+vL+v+Y++L ekDqaLFL+IA+ FN+  vdyV+
  gi|9954759   405 PRLKD----CLDGRIESVLKVGYESLYEKDQALFLLIAVYFNYDYVDYVT 450  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                   ++L+++n LDVr+GLk La+++LI+i+  +n+   + +++M++LLq ++R
  gi|9954759   451 SMLENTNVLDVRLGLKKLANRCLIQIDIDHNR---KSRVVMNRLLQVMAR 497  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtse
                   e ++ kQ+i      KR++L D+++Ic+VL++++G g  s lG slD+ e
  gi|9954759   498 E-VISKQKI-----SKRKILEDPQDICYVLEEAKGKG--SALGLSLDVAE 539  

                   ieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   i+ el+I++kAF++M+NL+ L++++ ++ +d k   
  gi|9954759   540 IK-ELVINKKAFKKMCNLLILKVFNGTDPRDSK    571  

gi|12323030|gb|AAG51507.1|AC058785_10: domain 1 of 1, from 181 to 571: score 791.4, E = 4.4e-233
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      rDFd++VG+ +Hl++m+sLL+L++ d+V++VGI+GPaGIGK+TIA A
  gi|1232303   181    RDFDGMVGLNDHLREMESLLDLKN-DGVKIVGISGPAGIGKSTIATA 226  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L+ +LS     + Fq ++F++nlr           e++++glDeY   +K
  gi|1232303   227 LHGRLS-----NMFQRTCFVDNLR-----------ESYKIGLDEYR--LK 258  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   LhLQ+q+L+ +Lnq+ i++  HL v++ERL d +VLIiLDDV++l QL+A
  gi|1232303   259 LHLQQQLLAYVLNQDKIRVG-HLSVMKERLDDLRVLIILDDVEHLYQLEA 307  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   LA+ ++WFGpGSR+IVTTe++++L +HgI++ IY+VgfPS++eAL+IFC+
  gi|1232303   308 LAD-IRWFGPGSRVIVTTENREILLQHGIKD-IYHVGFPSEGEALMIFCL 355  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   sAF+Q sPp+GF +L ++eV+ ++GnLPLGL+VlG  L+Gks+ +W+++L
  gi|1232303   356 SAFRQPSPPYGFLKL-TYEVASICGNLPLGLHVLGTLLWGKSQADWIEEL 404  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                   pRL+     +LDg+Ie+vL+v+Y++L ekDqaLFL+IA+ FN+  vdyV+
  gi|1232303   405 PRLKD----CLDGRIESVLKVGYESLYEKDQALFLLIAVYFNYDYVDYVT 450  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                   ++L+++n LDVr+GLk La+++LI+i+  +n+   + +++M++LLq ++R
  gi|1232303   451 SMLENTNVLDVRLGLKKLANRCLIQIDIDHNR---KSRVVMNRLLQVMAR 497  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtse
                   e ++ kQ+i      KR++L D+++Ic+VL++++G g  s lG slD+ e
  gi|1232303   498 E-VISKQKI-----SKRKILEDPQDICYVLEEAKGKG--SALGLSLDVAE 539  

                   ieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   i+ el+I++kAF++M+NL+ L++++ ++ +d k   
  gi|1232303   540 IK-ELVINKKAFKKMCNLLILKVFNGTDPRDSK    571  

gi|10177430|dbj|BAB10522.1|: domain 1 of 1, from 180 to 534: score 768.4, E = 3.5e-226
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      rDF+++                   d+V+M+GIwGPaGIGKTTIARA
  gi|1017743   180    RDFEGM-----------------C-DDVKMIGIWGPAGIGKTTIARA 208  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   Lf+qL+       F++s+Fm+n+                  +++Y+  +K
  gi|1017743   209 LFNQLF-----TGFRHSCFMGNID-----------------VNNYD--SK 234  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   L+L++++LSkILnqkD+kIh HLG+ieE+L++q+VLI+LDDVDdleQL++
  gi|1017743   235 LRLHNMLLSKILNQKDMKIH-HLGAIEEWLRNQRVLIVLDDVDDLEQLEV 283  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   LAke+ WFGpGSR+IVT +Dk++L+aHgIn+ IY+V++PS++ AL+IFC+
  gi|1017743   284 LAKESFWFGPGSRVIVTLKDKKILMAHGIND-IYHVDYPSQKKALEIFCL 332  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   sAF+Q+sP+dGFeeL Ar+V++L+GnLPL+LrV+GSs+ G+s++eW  +L
  gi|1017743   333 SAFKQSSPQDGFEEL-ARKVVELCGNLPLALRVVGSSFYGESEDEWRLQL 381  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                     ++t     LD+kIe vLrv+YD+L ek+q+LFLhIACfFN+e vdyV 
  gi|1017743   382 YGIET----NLDRKIEHVLRVGYDKLLEKHQSLFLHIACFFNHESVDYVS 427  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                   ++Lads  LDV++GLk+La KSL+his+        g ++MH+LLqqLGR
  gi|1017743   428 TMLADS-TLDVENGLKTLAAKSLVHIST-------HGLVRMHCLLQQLGR 469  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtse
                   + +V +Qs    ePgKRqFLv+a+eI+dVL+++T ++             
  gi|1017743   470 Q-VVVQQS---GEPGKRQFLVEAKEIRDVLANETMSK------------- 502  

                   ieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   i+ e++I +++FegM+NL+FL++y+   +  +    
  gi|1017743   503 IG-EFSIRKRVFEGMHNLKFLKFYNGNVSLLED    534  

gi|7488170|pir||D71437: domain 2 of 2, from 1304 to 1713: score 761.9, E = 3.3e-224
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      + F+dlVGiE+H+e++k+ LcL+sk+++ MVGIwG++GIGK+TI+RA
  gi|7488170  1304    KGFGDLVGIEDHIEAIKLKLCLESKEARIMVGIWGQSGIGKSTIGRA 1350 

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   LfsqLS     s+F+++aF++++++              +g+D  +  mK
  gi|7488170  1351 LFSQLS-----SQFHHRAFITYKST--------------SGSDVSG--MK 1379 

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   L++++++LS+IL+qkDikI+ H+Gv+e+RLk++KVLI LDDVD+le+L +
  gi|7488170  1380 LSWEKELLSEILGQKDIKIE-HFGVVEQRLKHKKVLILLDDVDNLEFLRT 1428 

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   L+++++WFG+GSRIIV+T+D+qLLkaH+I++ IYeV++PS+++AL++ C+
  gi|7488170  1429 LVGKAEWFGSGSRIIVITQDRQLLKAHEIDL-IYEVKLPSQGLALKMICQ 1477 

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   +AFg+ sPpd+F+eL A+eV+kLaGnLPLGL+VlGSsL+++skeeW++mL
  gi|7488170  1478 YAFGKYSPPDDFKEL-AFEVAKLAGNLPLGLSVLGSSLKRRSKEEWMEML 1526 

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                    +L++    +L+++I+k+LrvsY +L+ kDq++F +IA++FNg kv+ +k
  gi|7488170  1527 AELQN----GLNRDIMKTLRVSYVRLDPKDQDIFHYIAWLFNGWKVKSIK 1572 

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                   ++L+d   ++V+++Lk+L dKSLI+ +p       ++tieMHnLLq+L+ 
  gi|7488170  1573 DFLGD--GVNVNIRLKTLDDKSLIRLTP-------NDTIEMHNLLQKLAT 1613 

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnT................
                   e I+r++s++  +PgKR+FL +aeeI dV+tdnT +  +  ++    ++ 
  gi|7488170  1614 E-IDREESNG--NPGKRRFLENAEEILDVFTDNTvsfcslmhhfiliqrl 1660 

                   ...GtgtrsVlGIslD...tseiee.elnIsekAFegMrNLqFLriykks
                     +Gt+  + lGI++ +++ s i+++ ++I+e++F+gM NLqFL+i++++
  gi|7488170  1661 afdGTE--KLLGIDFStssDSQIDKpFISIDENSFQGMLNLQFLNIHDHY 1708 

                   frddgk<-*
                    ++++    
  gi|7488170  1709 -WWQPR    1713 

gi|7488170|pir||D71437: domain 1 of 2, from 18 to 386: score 760.6, E = 8.1e-224
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      ++Fdd+VGiEaH+e++ks LcL+sk e+rMVGIwG++GIGK+TI+RA
  gi|7488170    18    KCFDDFVGIEAHIEAIKSVLCLESK-EARMVGIWGQSGIGKSTIGRA 63   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   LfsqLS      +F l+aF +++++              +g+D  +  mK
  gi|7488170    64 LFSQLS-----IQFPLRAFLTYKST--------------SGSDVSG--MK 92   

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   L++++++LS+IL+qkDikI+ H+Gv+e+RLk++KVLI LDDVD+le+L++
  gi|7488170    93 LSWEKELLSEILGQKDIKIE-HFGVVEQRLKHKKVLILLDDVDNLEFLKT 141  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   L+++++WFG+GSRIIV+T+D+q+LkaH+I++ +YeV++PS+++AL+++Cr
  gi|7488170   142 LVGKAEWFGSGSRIIVITQDRQFLKAHDIDL-VYEVKLPSQGLALTMLCR 190  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   sAFg++sPpd+F+eL A+eV+kLaG+LPLGL+VlGSsLR++ k+eW++m+
  gi|7488170   191 SAFGKDSPPDDFKEL-AFEVAKLAGHLPLGLNVLGSSLRRRGKKEWMEMM 239  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                   pRLr+    +L+g+I+k+LrvsYD+Lh+kDq+               yVk
  gi|7488170   240 PRLRN----GLNGDIMKTLRVSYDRLHQKDQD--------------IYVK 271  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                   +lL+d+      +GL++L +KSLI+i+p       dg+ieMHnLL++LGR
  gi|7488170   272 DLLEDN------VGLTMLSEKSLIRITP-------DGHIEMHNLLEKLGR 308  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslD..t
                   e I+r++s++  +PgKRqFL+++e+I++V t++TGt+  + lGI+l  + 
  gi|7488170   309 E-IDRAKSKG--NPGKRQFLTNFEDIHEVVTEKTGTE--TLLGIRLPfeE 353  

                   seieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   +   + l I++++F+gMrNLq+L+i ++  +d g+   
  gi|7488170   354 YFSTRPLLIDKESFKGMRNLQYLKIGDW--SDGGQ    386  

gi|5302808|emb|CAB46049.1|: domain 1 of 1, from 182 to 548: score 752.2, E = 2.7e-221
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      + F+dlVGiE+H+e++k+ LcL+sk+++ MVGIwG++GIGK+TI+RA
  gi|5302808   182    KGFGDLVGIEDHIEAIKLKLCLESKEARIMVGIWGQSGIGKSTIGRA 228  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   LfsqLS     s+F+++aF++++++              +g+D  +  mK
  gi|5302808   229 LFSQLS-----SQFHHRAFITYKST--------------SGSDVSG--MK 257  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   L++++++LS+IL+qkDikI+ H+Gv+e+RLk++KVLI LDDVD+le+L +
  gi|5302808   258 LSWEKELLSEILGQKDIKIE-HFGVVEQRLKHKKVLILLDDVDNLEFLRT 306  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   L+++++WFG+GSRIIV+T+D+qLLkaH+I++ IYeV++PS+++AL++ C+
  gi|5302808   307 LVGKAEWFGSGSRIIVITQDRQLLKAHEIDL-IYEVKLPSQGLALKMICQ 355  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   +AFg+ sPpd+F+eL A+eV+kLaGnLPLGL+VlGSsL+++skeeW++mL
  gi|5302808   356 YAFGKYSPPDDFKEL-AFEVAKLAGNLPLGLSVLGSSLKRRSKEEWMEML 404  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                    +L++    +L+++I+k+LrvsY +L+ kDq++F +IA++FNg kv+ +k
  gi|5302808   405 AELQN----GLNRDIMKTLRVSYVRLDPKDQDIFHYIAWLFNGWKVKSIK 450  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                   ++L+d   ++V+++Lk+L dKSLI+ +p       ++tieMHnLLq+L+ 
  gi|5302808   451 DFLGD--GVNVNIRLKTLDDKSLIRLTP-------NDTIEMHNLLQKLAT 491  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtse
                   e I+r++s++  +PgKR+FL +aeeI dV+tdnT                
  gi|5302808   492 E-IDREESNG--NPGKRRFLENAEEILDVFTDNT---------------- 522  

                   ieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                         ++e++F+gM NLq+L+i+++s ++++    
  gi|5302808   523 ------VNENSFQGMLNLQYLKIHDHS-WWQPR    548  

gi|7488166|pir||A71437: domain 1 of 1, from 179 to 546: score 740.9, E = 6.9e-218
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      + F+d+VGiEaHle+m+s+LcL+sk e+rMVGIwGP+GIGK+TI++A
  gi|7488166   179    NSFGDFVGIEAHLEAMNSILCLESK-EARMVGIWGPSGIGKSTIGKA 224  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L+sqL+      +F+++aF+                      + Ys  mK
  gi|7488166   225 LYSQLF-----CQFHFHAFVP---------------------HVYS--MK 246  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                     ++e fLSkIL+ kDikI + LGv+e++L+++KVLI+LDDVDd e+L++
  gi|7488166   247 SEWEEIFLSKILG-KDIKIGGKLGVVEQMLNQKKVLIVLDDVDDPEFLKT 295  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   L++et+WFGpGSRIIV+T+D qLLkaH+I++  YeV+fPS ++AL+++Cr
  gi|7488166   296 LVGETKWFGPGSRIIVITQDMQLLKAHDIDL-LYEVKFPSLDLALKMLCR 344  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   sAFg+nsPpd+F+ L A+eV+ LaGnLPLGL+VlGSsL++++keeW++m+
  gi|7488166   345 SAFGENSPPDDFKAL-AFEVAVLAGNLPLGLSVLGSSLKRRTKEEWMEMM 393  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                   pR+r+    +L+g+I+k+LrvsYD+Lh+kDq++FL+IAC+FNg++v+yV 
  gi|7488166   394 PRFRN----GLNGDIMKTLRVSYDRLHQKDQDMFLYIACLFNGFEVSYVN 439  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                   +lL+d+      +G ++L++KSLI+i+p       dg ieMHnLL++LG 
  gi|7488166   440 DLLEDN------VGVTMLVEKSLIRITP-------DGDIEMHNLLEKLGI 476  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtse
                   e I+r++s++  +PgKR+FL+D+e        +T  +  +VlGI++ t  
  gi|7488166   477 E-IDRAKSKG--NPGKRRFLTDFE--------DTLRK--TVLGIRFCTAF 513  

                   iee.elnIsekAFegMrNLqFLriykksfrddgk<-*
                    +++ l I+ek+F+gMrNLq L++  ++ +d ++   
  gi|7488166   514 RSKeLLPIDEKSFQGMRNLQCLSVTGDY-MDLPQ    546  

gi|7488167|pir||B71437: domain 1 of 1, from 212 to 575: score 716.7, E = 1.3e-210
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      + F+dlVGiE+H+e++ks+LcL+sk++  MVGIwG++GIGK+TI+RA
  gi|7488167   212    KGFGDLVGIEDHIEAIKSILCLESKEAKIMVGIWGQSGIGKSTIGRA 258  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   LfsqLS     s+F l+aF++++++              +g+D  +  mK
  gi|7488167   259 LFSQLS-----SQFPLRAFVTYKST--------------SGSDVSG--MK 287  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   L++Q+++LS+IL+qkDikI+ H+Gv+e+RLk++KVLI LDDVD+le+L++
  gi|7488167   288 LSWQKELLSEILGQKDIKID-HFGVVEQRLKHKKVLILLDDVDNLEFLKT 336  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   L+++++WFG+GSRIIV+T+D+qLLkaH+I++ +YeV++PS+++ALq+  +
  gi|7488167   337 LVGKAEWFGSGSRIIVITQDRQLLKAHEIDL-VYEVKLPSQGLALQMISQ 385  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   +AFg++sPpd+F+ L A+eV++LaG+LPLGL+VlGSsL+G++k+eW++m+
  gi|7488167   386 YAFGKDSPPDDFKAL-AFEVAELAGSLPLGLSVLGSSLKGRDKDEWVKMM 434  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                   pRLr+      D+kIe++Lrv+YD                      ++Vk
  gi|7488167   435 PRLRN----DSDDKIEETLRVCYD----------------------SNVK 458  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                   +lL+d+      +GL++L++KSLI+i+p       dg ieMHnLL++LGR
  gi|7488167   459 ELLEDD------VGLTMLVEKSLIRITP-------DGDIEMHNLLEKLGR 495  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslD..t
                   e I+r++s++  +PgKRqFL+++e+I +VL+++TGt+    lGI+l ++ 
  gi|7488167   496 E-IDRAKSKG--NPGKRQFLTNFEDIQEVLAEKTGTE--ILLGIRLPhpG 540  

                   seieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   + + + + I+ek F+gMrNLq+L+i  +s++d ++   
  gi|7488167   541 YLTTRSFLIDEKLFKGMRNLQYLEIGYWSDGDLPQ    575  

gi|7485134|pir||E71436: domain 1 of 1, from 18 to 383: score 702.2, E = 3e-206
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      + F+d+VGiE+H++++ks+LcL+sk+++ MVGIwG++GIGK+TI+RA
  gi|7485134    18    KGFGDFVGIEDHIKAIKSILCLESKEARIMVGIWGQSGIGKSTIGRA 64   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   LfsqLS     s+F+++aF++++++              +g+D  +  mK
  gi|7485134    65 LFSQLS-----SQFHHRAFITYKST--------------SGSDVSG--MK 93   

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   L++++++LS+IL+qkDikI+ H+Gv+e+RLk++KVLI LDDVD+le+L++
  gi|7485134    94 LSWEKELLSEILGQKDIKID-HFGVVEQRLKHKKVLILLDDVDNLEFLKT 142  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   L+++++WFG+GSRIIV+T+DkqLLkaH+I++ +YeV++PS+++AL++  +
  gi|7485134   143 LVGKAEWFGSGSRIIVITQDKQLLKAHEIDL-VYEVELPSQGLALKMISQ 191  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   +AFg++sPpd+F+eL A+eV++L+G+LPLGL+VlGSsL+G++k+eW++m+
  gi|7485134   192 YAFGKDSPPDDFKEL-AFEVAELVGSLPLGLSVLGSSLKGRDKDEWVKMM 240  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                   pRLr+      D+kIe++Lrv+YD+L++k+               +d+Vk
  gi|7485134   241 PRLRN----DSDDKIEETLRVGYDRLNKKN---------------RDNVK 271  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                   +lL+d+      +GL++LadKSLI+i+p       dg ieMHnLL++LGR
  gi|7485134   272 ELLEDD------VGLTMLADKSLIRITP-------DGDIEMHNLLEKLGR 308  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslD..t
                   e I+r++s++  +P KRqFL+++e+I +V t++TGt+  +VlGI+  +++
  gi|7485134   309 E-IDRAKSKG--NPAKRQFLTNFEDIQEVVTEKTGTE--TVLGIRVPptV 353  

                   seiee.elnIsekAFegMrNLqFLriykksfrddgk<-*
                       ++ l+I+e++F+gM       i  +s++d ++   
  gi|7485134   354 LFSTRpLLVINEESFKGM------QIGLWSKIDLPQ    383  

gi|7268442|emb|CAB80962.1|: domain 1 of 1, from 179 to 529: score 697.8, E = 6.3e-205
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      + F+d+VGiEaHle+m+s+LcL+sk e+rMVGIwGP+GIGK+TI++A
  gi|7268442   179    NSFGDFVGIEAHLEAMNSILCLESK-EARMVGIWGPSGIGKSTIGKA 224  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L+sqL+      +F+++aF+                      + Ys  mK
  gi|7268442   225 LYSQLF-----CQFHFHAFVP---------------------HVYS--MK 246  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                     ++e fLSkIL+ kDikI + LGv+e++L+++KVLI+LDDVDd e+L++
  gi|7268442   247 SEWEEIFLSKILG-KDIKIGGKLGVVEQMLNQKKVLIVLDDVDDPEFLKT 295  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   L++et+WFGpGSRIIV+T+D qLLkaH+I++  YeV+fPS ++AL+++Cr
  gi|7268442   296 LVGETKWFGPGSRIIVITQDMQLLKAHDIDL-LYEVKFPSLDLALKMLCR 344  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   sAFg+nsPpd+F+ L A+eV+ LaGnLPLGL+VlGSsL++++keeW++m+
  gi|7268442   345 SAFGENSPPDDFKAL-AFEVAVLAGNLPLGLSVLGSSLKRRTKEEWMEMM 393  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                   pR+r+    +L+g+I+k+LrvsYD+Lh+kDq++FL+IAC+FNg++v+yV 
  gi|7268442   394 PRFRN----GLNGDIMKTLRVSYDRLHQKDQDMFLYIACLFNGFEVSYVN 439  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                   +lL+d+      +G ++L++KSLI+i+p       dg ieMHnLL++LG 
  gi|7268442   440 DLLEDN------VGVTMLVEKSLIRITP-------DGDIEMHNLLEKLGI 476  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtse
                   e I+r++s+                           +  +VlGI++ t  
  gi|7268442   477 E-IDRAKSK---------------------------E--TVLGIRFCTAF 496  

                   iee.elnIsekAFegMrNLqFLriykksfrddgk<-*
                    +++ l I+ek+F+gMrNLq L++  ++ +d ++   
  gi|7268442   497 RSKeLLPIDEKSFQGMRNLQCLSVTGDY-MDLPQ    529  

gi|8843806|dbj|BAA97354.1|: domain 1 of 1, from 117 to 478: score 665.8, E = 2.8e-195
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                       DF+        ++  + +L     de +    w  a      I   
  gi|8843806   117    GDFG--------MAFERTCLNKTE-DE-KN--LWRVALTHVANILGY 151  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                      q                                   a++D+Y+  mK
  gi|8843806   152 HSAQCR---------------------------------ANPDDYN--MK 166  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   LhLQe fLS IL++++ikI+ HLG+++ERLk+qKVL+++DD+D++++L A
  gi|8843806   167 LHLQETFLSTILGKQNIKID-HLGALGERLKHQKVLLFIDDLDQQVVLNA 215  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   LA+++qWFG+GSRIIV+T+Dk+LL +HgI++ IY+V++PSke+AL+++Cr
  gi|8843806   216 LAGQIQWFGSGSRIIVVTNDKHLLISHGIEN-IYQVCLPSKELALEMLCR 264  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   +AF+Qn+PpdGF++L A+eV+++aG LPLGL+VlGS+LRG++k +W+dmL
  gi|8843806   265 YAFRQNTPPDGFKKL-AVEVVRHAGILPLGLNVLGSYLRGRNKRYWMDML 313  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhek.DqaLFLhIACfFNgekvdyV
                   pRLr+    +LDgkI+k Lrv+YDgL++k+D a+F+hIAC+FN ekv+++
  gi|8843806   314 PRLRK----GLDGKIQKALRVGYDGLDNKkDEAIFRHIACLFNFEKVNDI 359  

                   kalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLG
                     lLads +L+ ++GL++L+dKSL++++          ++eMH+LLq++G
  gi|8843806   360 RLLLADS-DLNFNIGLENLVDKSLVNVR--------SNIVEMHCLLQEMG 400  

                   ReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDts
                   Re IVr+Qs+   e g+R+FL+D+e+IcdVL+dn+Gt+  ++lGIslD++
  gi|8843806   401 RE-IVRAQSN---EAGEREFLMDTEDICDVLDDNIGTK--KMLGISLDVD 444  

                   eieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   ei++eln++ekAF+gMrNL+FL+iy+k  ++ +k   
  gi|8843806   445 EIDHELNVHEKAFQGMRNLRFLNIYTKALMSGQK    478  

gi|9759045|dbj|BAB09567.1|: domain 1 of 1, from 181 to 567: score 513.1, E = 2.5e-149
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                       D  +l+G+  H+  ++s+     k +VrM GIwG  G+GKTTIA+ 
  gi|9759045   181    DDSKGLIGMSSHMDFLQSMISIVDK-DVRMLGIWGMGGVGKTTIAKY 226  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L++qLS      +Fq ++Fmen++                ++ ++ yG+ 
  gi|9759045   227 LYNQLS-----GQFQVHCFMENVK----------------EVCNR-YGVR 254  

                   LhLQeqfLSkILnqkDik....IhdHLGvieERLkdqKVLIiLDDVDdle
                    +LQ +fL  ++   D +  ++++  +  i+ER +++ V+I+LDDVD +e
  gi|9759045   255 -RLQVEFLCRMFQERDKEawssVS-CCNIIKERFRHKMVFIVLDDVDRSE 302  

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   QL  L+ket WFGpGSRIIVTT D++LL +HgIn+ +Y+V+   k+eALq
  gi|9759045   303 QLNELVKETGWFGPGSRIIVTTRDRHLLLSHGINL-VYKVKCLPKKEALQ 351  

                   IFCrsAFgQnsP.pdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskee
                    FC +AF++    p+GFeeL +++ ++ a  LPL+LrVlGS L ++s+ e
  gi|9759045   352 LFCNYAFREEIIlPHGFEEL-SVQAVNYASGLPLALRVLGSFLYRRSQIE 400  

                   WedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgek
                   We +L RL+t      + +I++vLrvsYDgL+e+++a+FL+I Cf N + 
  gi|9759045   401 WESTLARLKT----YPHSDIMEVLRVSYDGLDEQEKAIFLYISCFYNMKQ 446  

                   vdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLL
                   vdyV +lL        ++G ++L++KSLI  s        +g+++ H+LL
  gi|9759045   447 VDYVRKLLDLC-GYAAEIGITILTEKSLIVES--------NGCVKIHDLL 487  

                   qqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIs
                   +q+GRe  Vr+Q +  ++P +R  L D+e+Ic  L++n+Gt+   V GIs
  gi|9759045   488 EQMGRE-LVRQQAV--NNPAQRLLLWDPEDICHLLSENSGTQ--LVEGIS 532  

                   lDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   l++sei+ e++ s++AFeg++NL+ L++y+   ++dg+   
  gi|9759045   533 LNLSEIS-EVFASDRAFEGLSNLKLLNFYDL--SFDGE    567  

gi|10944739|emb|CAC14089.1|: domain 1 of 1, from 176 to 522: score 428.5, E = 7.5e-124
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      + F d+VGiEaH+e++ s+L++dsk  +rM+GI+GP+  GKTTI+RA
  gi|1094473   176    NNFSDFVGIEAHIEALISMLRFDSK-KARMIGICGPSETGKTTIGRA 221  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L+s+L      s+F+++aF+ ++r+++s               +Y+   K
  gi|1094473   222 LYSRLK-----SDFHHRAFVAYKRKIRS---------------DYD--QK 249  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   L ++eqfLS+IL+qkDikI+  +G++e+RLk+ KVLI+LDDVDd+e+L++
  gi|1094473   250 LYWEEQFLSEILCQKDIKIE-ECGAVEQRLKHTKVLIVLDDVDDIELLKT 298  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   L++ ++WFG+ S I+V+T+ ++LLkaH+I h +YeVgfPS+e+A q+FCr
  gi|1094473   299 LVGRIRWFGSESKIVVITQKRELLKAHNIAH-VYEVGFPSEELAHQMFCR 347  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   +AFg+nsPp+GF+eL A e +k+aGn P +L+ +GSs+R+ +ke W++mL
  gi|1094473   348 YAFGKNSPPHGFNEL-ADEAAKIAGNRPKALKYVGSSFRRLDKEQWVKML 396  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                    ++r+      +g+    L++sYD+L+ k q+   ++AC+ Ng++ + Vk
  gi|1094473   397 SEFRS------NGN---KLKISYDELDGKGQD---YVACLTNGSN-SQVK 433  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                   a   +   L V++         L +i++ g+   + ++   ++   q + 
  gi|1094473   434 AEWIHL-ALGVSI---------LLNIRSDGTT--ILKHLSYNRSMAQQA- 470  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtse
                   + I   +                      L+        ++ GI+  t++
  gi|1094473   471 K-IWWYEN---------------------LERVCKKY--NICGIDSSTDG 496  

                   ieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                    +       +     +N qF r  + s +  +    
  gi|1094473   497 GG-------STYGQCSNSQFQRNMDASPGGNKT    522  

gi|7488174|pir||A71438: domain 1 of 1, from 403 to 742: score 413.5, E = 2.4e-119
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      + F d+VGiEaH+e++ s+L++dsk  +rM+GI+GP+  GKTTI+RA
  gi|7488174   403    NNFSDFVGIEAHIEALISMLRFDSK-KARMIGICGPSETGKTTIGRA 448  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L+s+L      s+F+++aF+ ++r+++s               +Y+   K
  gi|7488174   449 LYSRLK-----SDFHHRAFVAYKRKIRS---------------DYD--QK 476  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   L ++eqfLS+IL+qkDikI+  +G++e+RLk+ KVLI+LDDVDd+e+L++
  gi|7488174   477 LYWEEQFLSEILCQKDIKIE-ECGAVEQRLKHTKVLIVLDDVDDIELLKT 525  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   L++ ++WFG+ S I+V+T+ ++LLkaH+I h +YeVgfPS+e+A q+FCr
  gi|7488174   526 LVGRIRWFGSESKIVVITQKRELLKAHNIAH-VYEVGFPSEELAHQMFCR 574  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   +AFg+nsPp+GF+eL A e +k+aGn P +L+ +GSs+R+ +ke W++mL
  gi|7488174   575 YAFGKNSPPHGFNEL-ADEAAKIAGNRPKALKYVGSSFRRLDKEQWVKML 623  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFN.gekvdyV
                    ++r+      +g+    L++sYD+L+ k q+   ++AC+ N+       
  gi|7488174   624 SEFRS------NGN---KLKISYDELDGKGQD---YVACLTNgSTYGQCS 661  

                   kalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLG
                    ++     n D + G     +K   + +  + +                +
  gi|7488174   662 NSQFQ-R-NMDASPG----GNKTSNQSTKDSPR----------------A 689  

                   ReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDts
                    +  V k++i   e+ + +  + +     +++d+T               
  gi|7488174   690 SQ--VEKEKI---EYCEPHVYITPA----IFSDGTRAP------------ 718  

                   eieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                     +   +++ + +   +NL  L +y +  ++ +k   
  gi|7488174   719 --K---YVESRILS--SNLE-LGFYIN--QSFNK    742  

gi|6721164|gb|AAF26792.1|AC016829_16: domain 1 of 1, from 209 to 505: score 396.0, E = 4.5e-114
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                       DF dlVG+E+H++k++ +L Ld  ++VrM+GIwGP+GIGKT IAR+
  gi|6721164   209    SDFSDLVGMEDHMKKLERMLYLDL-NDVRMIGIWGPPGIGKTSIARV 254  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   Lf ++S     +sF ls+Fme ++g          +trp ++De++  +K
  gi|6721164   255 LFRKHS-----DSFDLSVFMETVKG----------YTRPGCSDEHG--LK 287  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   LhLQ+qfLS+I+nqkD++++ HLGv+++RL+d++VL++LDDVD++ QL+A
  gi|6721164   288 LHLQQQFLSQIFNQKDVEVP-HLGVVQDRLRDKRVLVVLDDVDQSAQLEA 336  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   +Ake +WFGpGSRII+TT+D+ LLkaHgI++ +Y+V++P  ++A+qIFC+
  gi|6721164   337 MAKENKWFGPGSRIIITTQDRRLLKAHGIKD-VYKVDLPPPDDAFQIFCM 385  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   +AFg++sP++GFeeL A+e t L G  P G + +GS++R +sk eW+++L
  gi|6721164   386 YAFGKTSPKHGFEEL-AWEATYLSGIHPSGIKSMGSYFRKMSKPEWVNAL 434  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                    RLrts    LD +                             + +++ k
  gi|6721164   435 QRLRTS---KLDSE-----------------------------SPRTHRK 452  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                     L +         L +  +K L +  +                      
  gi|6721164   453 --LINR--------LRNVKQKMLSNTLS---------------------- 470  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtse
                     I rk+ i             a       + ++  +          ++e
  gi|6721164   471 R-I-RKHQI-------------AS------AAAKAAS----------VYE 489  

                   ieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   ++    I e++             ++s  + ++   
  gi|6721164   490 TS----IKEEV-------------DSSAESLNH    505  

gi|5302809|emb|CAB46050.1|: domain 1 of 1, from 176 to 438: score 382.0, E = 7.7e-110
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      + F d+VGiEaH+e++ s+L++dsk  +rM+GI+GP+  GKTTI+RA
  gi|5302809   176    NNFSDFVGIEAHIEALISMLRFDSK-KARMIGICGPSETGKTTIGRA 221  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L+s+L      s+F+++aF+ ++r+++s               +Y+   K
  gi|5302809   222 LYSRLK-----SDFHHRAFVAYKRKIRS---------------DYD--QK 249  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   L ++eqfLS+IL+qkDikI+  +G++e+RLk+ KVLI+LDDVDd+e+L++
  gi|5302809   250 LYWEEQFLSEILCQKDIKIE-ECGAVEQRLKHTKVLIVLDDVDDIELLKT 298  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   L++ ++WFG+ S I+V+T+ ++LLkaH+I h +YeVgfPS+e+A q+FCr
  gi|5302809   299 LVGRIRWFGSESKIVVITQKRELLKAHNIAH-VYEVGFPSEELAHQMFCR 347  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   +AFg+nsPp+GF+eL A e +k+aGn P +L+ +GSs+R+ +ke W++mL
  gi|5302809   348 YAFGKNSPPHGFNEL-ADEAAKIAGNRPKALKYVGSSFRRLDKEQWVKML 396  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                    ++r+      +g+    L++sYD+L+ k q+   ++AC+ Ngek     
  gi|5302809   397 SEFRS------NGN---KLKISYDELDGKGQD---YVACLTNGEK----- 429  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                                       KS+ +i                        
  gi|5302809   430 --------------------KSILKII----------------------- 436  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtse
                    A                                   +            
  gi|5302809   437 -A-----------------------------------W------------ 438  

                   ieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                       
  gi|5302809     - ---------------------------------    -    

gi|9758876|dbj|BAB09430.1|: domain 1 of 1, from 181 to 569: score 372.6, E = 5e-107
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                        F+dlVG+EaH+e+++ LL  d + eV MVGIwG  GIGKTTIA+ 
  gi|9758876   181    TSFEDLVGMEAHMENIRPLLKKDFDAEVCMVGIWGMGGIGKTTIAKY 227  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L+ qL      s+F  + F+e +                ++    +  +K
  gi|9758876   228 LYEQLA-----SQFPAHSFIEDVGQ--------------ICKKV-D--LK 255  

                   LhLQeqfLSkILnqkD...ikIhdHLGvieERLkdqKVLIiLDDVDdleQ
                    + Q+q+L  IL  k    + I +    i+ RL   KVL +LD+VD++eQ
  gi|9758876   256 -CIQQQLLCDILSTKRvalMSIQNGANLIRSRLGTLKVLFVLDGVDKVEQ 304  

                   LdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqI
                   L ALAke++WFGpGSRII+TT D+ LL + ++ ++ YeV+   +e+ L+I
  gi|9758876   305 LHALAKEASWFGPGSRIIITTRDRRLLDSCRVTNK-YEVKCLQNEDSLKI 353  

                   FCrsAFgQnsPp.dGFeeLeAreVtkLaGnLPLGLrVlGSsLRG.kskee
                       AF    P  dG+e   A +   La  LPL+L   GS LRG  s +e
  gi|9758876   354 VKNIAFAGGVPTlDGYERF-AIRASQLAQGLPLALVAFGSFLRGaTSIDE 402  

                   WedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgek
                   Wed++  L+t      +++I+++Lr sY  L+ +D+ +F  +AC+FNge 
  gi|9758876   403 WEDAIDTLET----APHQNIMDILRSSYTNLDLRDKTIFIRVACLFNGEP 448  

                   vdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLL
                   v++V +lL ++     + + k La+KSLIhis        dg+i  H+L 
  gi|9758876   449 VSRVSTLLSET-----KRRIKGLAEKSLIHISK-------DGYIDIHSLI 486  

                   qqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIs
                    q++Re IV ++s   + P++ ++L D++  + VL+ +TGt+  ++ G+ 
  gi|9758876   487 KQMARE-IVVEESL--YIPRQQRILWDPHNSYGVLESKTGTE--RIQGMT 531  

                   lDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   l+++e+ +  +I+ +AFe M NL FL+++k++++++ k   
  gi|9758876   532 LHMCELPRAASIDGSAFEQMENLIFLKFFKHLNDRESK    569  

gi|8778469|gb|AAF79477.1|AC022492_21: domain 1 of 1, from 179 to 569: score 351.1, E = 1.5e-100
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                       D +++VG++aH+e ++ LL+ +s +eV  VGIwG  GIGKT I + 
  gi|8778469   179    IDSGNIVGMKAHMEGLNHLLDQES-NEVLLVGIWGMGGIGKTSIVKC 224  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L++qLS      +F  ++F+en++           + ++ + ++    +K
  gi|8778469   225 LYDQLS-----PKFPAHCFIENIK-----------SVSKDNGHD----LK 254  

                   LhLQeqfLSkILnqkDikIhdHLGv....ieERLkdqKVLIiLDDVDdle
                    hLQ+++LS IL+ +Di+      ++ ++i+ RL +qKV+++LD+VD++ 
  gi|8778469   255 -HLQKELLSSILC-DDIRLW-SVEAgcqeIKKRLGNQKVFLVLDGVDKVA 301  

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   Q  ALAke +WFGpGSRII+TT D  LL   g++  +YeV+   +++ALq
  gi|8778469   302 QVHALAKEKNWFGPGSRIIITTRDMGLLNTCGVEV-VYEVKCLDDKDALQ 350  

                   IFCrsAFgQnsPp.dGFeeLeAreVtkLaGnLPLGLrVlGSsLRGk..sk
                   +F + AF    Pp +GF +L + +  kLa  LP +       LRG++ s 
  gi|8778469   351 MFKQIAFEGGLPPcEGFDQL-SIRASKLAHGLPSAIQAYALFLRGRtaSP 399  

                   eeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNg
                   eeWe++L  L++    sLD++I+++L++sY+gL + +q  FLh+ C+FNg
  gi|8778469   400 EEWEEALGALES----SLDENIMEILKISYEGLPKPHQNVFLHVVCLFNG 445  

                   ekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHn
                    +  ++++lL        +++  vLa+KSLI+is+       +g + MH+
  gi|8778469   446 DTLQRITSLLHGP-IPQSSLWIRVLAEKSLIKIST-------NGSVIMHK 487  

                   LLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlG
                   L +q+GRe I+r           R+FL D+ eI+  L+   G +      
  gi|8778469   488 LVEQMGRE-IIRDDM-----SLARKFLRDPMEIRVALAFRDGGE--QTEC 529  

                   IslDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   + l+t+ + ++l+++ ++  +M+NL+FL++yk+ + ++ +   
  gi|8778469   530 MCLHTCDMTCVLSMEASVVGRMHNLKFLKVYKHVDYRESN    569  

gi|5903073|gb|AAD55631.1|AC008017_4: domain 1 of 1, from 153 to 527: score 345.8, E = 5.8e-99
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                       D  +lVG+EaH+ km +LL    +deV M+GIwG  GIGK+TIA+ 
  gi|5903073   153    TDLINLVGMEAHMMKMTLLLNIGCEDEVHMIGIWGMGGIGKSTIAKC 199  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L++++S     ++F  ++F en++                    Y+   K
  gi|5903073   200 LYDRFS-----RQFPAHCFLENVS------------------KGYD--IK 224  

                   LhLQeqfLSkILnqkDikIhdHLGv....ieERLkdqKVLIiLDDVDdle
                    hLQ+++LS IL  +D++      +++++i+ERL +qKV+++LD VD++e
  gi|5903073   225 -HLQKELLSHILYDEDVELW-SMEAgsqeIKERLGHQKVFVVLDNVDKVE 272  

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   QL  LAk+ +WFGpGSRII+TT Dk LL + g+n+ IYeV+   +++ALq
  gi|5903073   273 QLHGLAKDPSWFGPGSRIIITTRDKGLLNSCGVNN-IYEVKCLDDKDALQ 321  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRG.kskee
                    F   AFg   P dGFe+L   +  +La  LP +L    S+L      +e
  gi|5903073   322 VFKKLAFGGRPPSDGFEQL-FIRASRLAHGLPSALVAFASHLSAiVAIDE 370  

                   WedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgek
                   Wed+L  L+t        +++++Lr sYDgL++ D+  FLh+ACfFNg +
  gi|5903073   371 WEDELALLET----FPQKNVQEILRASYDGLDQYDKTVFLHVACFFNGGH 416  

                   vdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLL
                     y+ a+L +        + + La K+L++is        dg+i MH LL
  gi|5903073   417 LRYIRAFLKNC-----DARINHLAAKCLVNISI-------DGCISMHILL 454  

                   qqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIs
                   +q GRe IVr++s d   P K +FL D+ eI++VL+ nT  g        
  gi|5903073   455 VQTGRE-IVRQES-D-WRPSKQRFLWDPTEIHYVLDSNTHLG-------- 493  

                   lDtseiee.elnIsekAFegMrNLqFLriykksfrddgk<-*
                       ++++ +l+ ++ ++ +  NL+ L+ +       ++   
  gi|5903073   494 ---GNVSNlQLISDDYVLSR--NLKLLHWDAYPLTILPP    527  

gi|9758746|dbj|BAB09118.1|: domain 1 of 1, from 180 to 562: score 345.5, E = 7.4e-99
                   *->rDFddlVGiEaHlekmksLLcLdsk.deVrMVGIwGPaGIGKTTIAR
                       DF ++VG + Hl+ +ksLL++ds +deVrM+GIwG  GIGKTTIA+
  gi|9758746   180    IDFRNFVGVDTHLQGLKSLLDMDSNnDEVRMIGIWGMGGIGKTTIAK 226  

                   ALfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGm
                    L++qLS     s+F  s F   ++g++            ++lD      
  gi|9758746   227 CLYDQLS-----SQFTASYFTQDIKGIH------------KELDL----- 254  

                   KLhLQeqfLSkILnqkDik...IhdHLGvieERLkdqKVLIiLDDVDdle
                    LhLQ+++L   L+ +Di++ +++    vi  RL ++KVL++LD+VD+l+
  gi|9758746   255 -LHLQNRLLYNTLG-DDIMpwsVEAGREVIAARLGNHKVLLVLDGVDKLV 302  

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   Q  ALAket+WFG  SRII+TT Dk LL + g++  IY V+   +++ Lq
  gi|9758746   303 QIHALAKETRWFGRQSRIIITTRDKGLLNSCGVKT-IYDVKCLDDKDSLQ 351  

                   IFCrsAFgQnsPp.dGFeeLeAreVtkLaGnLPLGLrVlGSsLRGk..sk
                   +F + AF   sPp+ +Fe+L + + ++La  LP +L      LRG+ +s 
  gi|9758746   352 MFKQIAFEGGSPPsVDFEQL-SIRAARLAHGLPSALQAYALFLRGRanSP 400  

                   eeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNg
                   eeWe++   L++      D++I+++L++sY+gL + +q  FLh+AC+FNg
  gi|9758746   401 EEWEEAVCGLES----TPDENIMEILKISYEGLAKAHQNAFLHVACLFNG 446  

                   ekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHn
                    +  +V++lL  s     +++  vLa+KSLI+i++       +g++  H+
  gi|9758746   447 DTFRRVTSLLDVS-RMESNLWMRVLAEKSLINITS-------NGYVTLHK 488  

                   LLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlG
                   L +q+GRe I  +           +F  D+e I+d L  +   +      
  gi|9758746   489 LVEQMGRE-IMLASG---------KFIGDPETIHDTLGMGQTES------ 522  

                   IslDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   Isl+++e+ + +++   +F +M  L+FL++yk+ + ++ +   
  gi|9758746   523 ISLHICEMTCAFSMATGVFSRMYKLRFLKVYKHVNERESM    562  

gi|7484921|pir||T06143: domain 1 of 2, from 178 to 532: score 325.5, E = 7.5e-93
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      +DF d+VGiEaHle+m+s+L+L+s + +rMVGI+GP+GIGKTTIA+A
  gi|7484921   178    NDFSDIVGIEAHLEAMSSILRLKS-EKARMVGISGPSGIGKTTIAKA 223  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   Lfs+LS      +F+l+aF++++r+++               D+Y+  mK
  gi|7484921   224 LFSKLS-----PQFHLRAFVTYKRTNQ---------------DDYD--MK 251  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   L++ e+fLS+IL+qkD+k+  +LG++e+ L+++KVLIiLDDVDdle+L++
  gi|7484921   252 LCWIEKFLSEILGQKDLKVL-DLGAVEQSLMHKKVLIILDDVDDLELLKT 300  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   L+++t WFG GSRI+V+T+D+qLLkaH+In+ IYe g    ++A++  +r
  gi|7484921   301 LVGQTGWFGFGSRIVVITQDRQLLKAHDINL-IYE-G---LGLAMKGKHR 345  

                   sAFgQnsPpdGFeeL.eAreVtkLaGnLPLGLrVlGSsLRG.....kske
                     + ++ P+   ++L++ +   +L  +LP   r   S+  G++++ k+ +
  gi|7484921   346 EEWIEMLPRLR-NDLdG-KFKKTLRNYLP-VIRKRVSNEEGgreklKKGN 392  

                   eWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhek.DqaLFLhIACfFNg
                      d+  ++  +    ++ +        + + ++ +  ++   IA     
  gi|7484921   393 KKLDLDEEFPGG---EIYSDEIPSPTSNWKDTDDFdSGDIIPIIADKSTT 439  

                   ekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHn
                    + ++ ++             ++  ++    +i pl+        +  ++
  gi|7484921   440 IIPNRRHSNDD----------WCSFCEFLRNRIPPLN-----PFKCSAND 474  

                   LLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlG
                       L                  Rq L  +e   d L   +         
  gi|7484921   475 VIDFLR----------------TRQVLGSTEALVDRLIFSSEAF------ 502  

                   IslDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                              +  +e+ F+      +L+  ++++r ++    
  gi|7484921   503 ----------GIKPEENPFRSQAVTSYLKAARDMTREKEC    532  

gi|12322617|gb|AAG51311.1|AC026480_18: domain 1 of 1, from 194 to 429: score 311.2, E = 1.6e-88
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      +DFd++VGi+aHl+k++sLL Ld+ d V++VGI+GPaGIGK+TIARA
  gi|1232261   194    KDFDEMVGIKAHLTKIESLLSLDY-DKVKIVGISGPAGIGKSTIARA 239  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L+++LS     ssF+ls+Fmenl          S ++ p+++ eYs  +K
  gi|1232261   240 LHNLLS-----SSFHLSCFMENLI---------S-QSNPHSSLEYS--SK 272  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   L+LQeq+LS++Ln kDi+I+ HLG+i+ERL+dq+VLIiLDDV  leQL++
  gi|1232261   273 LSLQEQLLSQVLNEKDIRIR-HLGAIQERLHDQRVLIILDDVTSLEQLEV 321  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   LA+ ++W+GpGSRIIV+T+ k +L +HgI + IY+VgfP++ +AL+IFC+
  gi|1232261   322 LAN-IKWYGPGSRIIVITKKKDILVQHGICD-IYHVGFPTDADALKIFCL 369  

                   sAFgQnsPpdGFeeL.eAreVtkLaGnLPLGLrVlGSsLRGkskeeWedm
                   sA++Q+sPpdG ++++e++ ++k++GnLPL L+VlGS+LRG+s       
  gi|1232261   370 SAYRQTSPPDGSMKIhECEMFIKICGNLPLHLHVLGSALRGRS------- 412  

                   LpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyV
                               +g      rv                            
  gi|1232261   413 ------------YG------RV---------------------------- 416  

                   kalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLG
                         s        L++L+        +l                    
  gi|1232261   417 -----QS--------LCNLV--------SL-------------------- 425  

                   ReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDts
                     A                                               
  gi|1232261   426 --A----------------------------------------------- 426  

                   eieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                  d     
  gi|1232261   427 -------------------------------DFV    429  

gi|5903075|gb|AAD55633.1|AC008017_6: domain 1 of 1, from 179 to 574: score 302.4, E = 7e-86
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                       DF d+VG+ aH+e+++ LL +ds++eVrM+GIwG  GIGKTTIA+ 
  gi|5903075   179    VDFSDIVGMNAHMERLSPLLSMDSENEVRMIGIWGMGGIGKTTIAKC 225  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   Lf+q+S       F  ++F en++++y                  s    
  gi|5903075   226 LFDQFS-----QGFPARCFLENVSKIY------------RKGGVSS---- 254  

                   LhLQeqfLSkILnqkDikIhdHLGv......ieERLkdqKVLIiLDDVDd
                     L e+fLS  L+    k     Gv+ ++++i+ R   +KV+++LD VDd
  gi|5903075   255 --LAEKFLSTTLGLSKKKMK-GSGVklgpqeIKARFGCRKVFVVLDNVDD 301  

                   leQLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeA
                     Q  A A e++WFGpGSRII+TT Dk LL  +g+   +YeV+   ++ A
  gi|5903075   302 MRQMHAFAQESSWFGPGSRIIITTRDKGLLNTYGVRT-VYEVKCMDNDAA 350  

                   LqIFCrsAFgQnsPp.dGFeeLeAreVtkLaGnLPLGLrVlGSsLRGk.s
                   Lq F + AF+   Pp++ +e+L + +  +La  LP +    G  +R+++s
  gi|5903075   351 LQLFNQLAFKGALPPsELYEKL-SIRASWLAQGLPVAIEAYGLFFRRMtS 399  

                   keeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFN
                    +eW d+L R+        D+ ++++L++sYDgL e D+  FLh+AC+FN
  gi|5903075   400 LKEWDDALCRFIE----APDESVMEILKISYDGLEETDKNVFLHVACLFN 445  

                   gekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMH
                   ge   + ++lL d   L   +GLk+La+KSLI i+         g+i+MH
  gi|5903075   446 GEPLRRATTLLDDG-VLQGCLGLKILAEKSLIEITA-------SGYIKMH 487  

                   nLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVl
                   nL  q +R  IV ++s   +    R  L ++ eI++ L  nT  +     
  gi|5903075   488 NLVDQTARA-IVNQESM--QRRHGRGVLWNPYEIYELLKRNTP-Q--DLV 531  

                   GIslD....tseieeelnIsekAFeg.MrNLqFLriykksfrddgk<-*
                    I l++++ ts  + e ++  kA+ ++M    +L + + + ++      
  gi|5903075   532 EIILHrsnlTSFWK-ETVV--KALNRsMLITMYLLVLNILAIFLFF    574  

gi|3947735|emb|CAA08798.1|: domain 1 of 1, from 196 to 571: score 290.0, E = 3.6e-82
                   *->rDFddlVGiEaHlekmksLL.cLdskdeVrMVGIwGPaGIGKTTIAR
                          +lVGi+ H ++++sLL  L    +V +VGIwG +G+GKTTIAR
  gi|3947735   196    ----NLVGIDTHFKNIRSLLaELQM-SGVLIVGIWGMPGVGKTTIAR 237  

                   ALfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGm
                   A f++LS      +F+  +F   ++              +++   +s   
  gi|3947735   238 AIFDRLS-----YQFEAVCFLADIK-------------ENKCGM-HS--- 265  

                   KLhLQeqfLSkILnqkDikIhdH....LGvieERLkdqKVLIiLDDVDdl
                      LQ+ +LS++L+ kD  ++ +++++   +  RL+ +KVL++LDD+D++
  gi|3947735   266 ---LQNILLSELLKEKDNCVN-NkedgRSLLAHRLRFKKVLVVLDDIDHI 311  

                   eQLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPS..kee
                   +QLd LA+   WFG+GSRII TT Dk+L      n  +Ye  +P+ ++++
  gi|3947735   312 DQLDYLAGNLDWFGNGSRIIATTRDKHLIGK---NV-VYE--LPTlhDHD 355  

                   ALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGksk
                   A + F r+AF++      F+eL + eV+ +a  LPL+L+V G  ++ ++ 
  gi|3947735   356 AIKLFERYAFKEQVSDKCFKEL-TLEVVSHAKGLPLALKVFGCFFHERDI 404  

                   eeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNg
                    eW  ++  +++      + +I + L++sYDgL    q++FL IACf +g
  gi|3947735   405 TEWRSAIKQIKN----NPNSEIVEKLKISYDGLETIQQSIFLDIACFLRG 450  

                   ekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHn
                   +  dyV + L+   +    +GL vL dKSL++is        + tieMH+
  gi|3947735   451 RRKDYVMQILESC-DFGADIGLSVLIDKSLVSISG-------NNTIEMHD 492  

                   LLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlG
                   L q +G+  +V kQ+    +Pg+R  L  +++  +V  +nTGt+  +V  
  gi|3947735   493 LIQDMGKY-VVKKQK----DPGERSRLWLTKDFEEVMINNTGTK--AVEA 535  

                   IslD.tseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   I   + ++       s++A   M  L+ L i+++ +  dg    
  gi|3947735   536 IWVPnFNRPR----FSKEAMTIMQRLRILCIHDS-NCLDGS    571  

gi|12056928|gb|AAG48132.1|AF322632_1: domain 1 of 1, from 188 to 575: score 288.9, E = 7.8e-82
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         d  VG+E  + + + LL+  s  +V M+GI+G  GIGKTT ARA
  gi|1205692   188    ---DRPVGLEYRMLEVDWLLDATSLAGVHMIGICGIGGIGKTTLARA 231  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    +           F  s+F +n+r++            ++gl        
  gi|1205692   232 VYHSAA-----GHFDTSCFLGNVRENA----------MKHGLV------- 259  

                   LhLQeqfLSkILnqkDikIh....dHLGvieERLkdqKVLIiLDDVDdle
                    hLQ+ +L++I++ ++i+  + +++    i+ +L  ++ L++LDDV  l+
  gi|1205692   260 -HLQQTLLAEIFRENNIRLTsveqG-ISLIKKMLPRKRLLLVLDDVCELD 307  

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                    L AL++   WFGpGSR+I+TT D++LLkaHg++  +YeV+   ++eAL+
  gi|1205692   308 DLRALVGSPDWFGPGSRVIITTRDRHLLKAHGVDK-VYEVEVLANGEALE 356  

                   IFCrsAFgQnsPpdGF.eeLeAreVtkLaGnLPLGLrVlGSsLRGkskee
                    +C  AF+ +  + +F ++L  ++ ++ a   PL+L   GSsL G+  ee
  gi|1205692   357 LLCWKAFRTDRVHPDFiNKL--NRAITFASGIPLALELIGSSLYGRGIEE 404  

                   WedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgek
                   We +L   ++       ++I   L++s+D+L   +++ FL IACfFNg++
  gi|1205692   405 WESTLDQYEK----NPPRDIHMALKISFDALGYLEKEVFLDIACFFNGFE 450  

                   vdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLL
                      ++  L++      ++    L++KSLI i++        g++ MH+L 
  gi|1205692   451 LAEIEHILGAHHGCCLKFHIGALVEKSLIMIDE-------HGRVQMHDLI 493  

                   qqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIs
                   qq+GRe IVr++s   + PgKR  L  +e+I  VL+dnTGt   ++  I 
  gi|1205692   494 QQMGRE-IVRQESP--EHPGKRSRLWSTEDIVHVLEDNTGTC--KIQSII 538  

                   lDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   lD s+ e+++  +  AF +M  L+ L i k +f++ +k   
  gi|1205692   539 LDFSKSEKVVQWDGMAFVKMISLRTLIIRK-MFSKGPK    575  

gi|1086263|pir||A54810: domain 1 of 1, from 187 to 570: score 265.9, E = 6.8e-75
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                          ++VGi+ Hlek++sLL     ++Vr+ GIwG  G+GKTTIARA
  gi|1086263   187    ----NIVGIDTHLEKIESLLEIGI-NGVRIMGIWGMGGVGKTTIARA 228  

                   LfsqLSerhFq.ssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGm
                    f+ L  r   + +F   +F   ++++                  +s   
  gi|1086263   229 IFDTLLGRMDSsYQFDGACFLKDIKENKR--------------GMHS--- 261  

                   KLhLQeqfLSkILnqk...DikIhdHLGvieERLkdqKVLIiLDDVDdle
                      LQ+ +LS++L+ k + + + +     +  RL+ +KVLI+LDD+D+ +
  gi|1086263   262 ---LQNALLSELLREKanyNNEED-GKHQMASRLRSKKVLIVLDDIDNKD 307  

                   .QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeAL
                   + L+ LA++  WFG+GSRII+TT Dk+L +  +I   IYeV    ++e  
  gi|1086263   308 hYLEYLAGDLDWFGNGSRIIITTRDKHLIEKNDI---IYEVTALPDHESI 354  

                   qIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskee
                   q F ++AFg+  P + Fe+L + eV++ a  LPL+L+V GS L+     e
  gi|1086263   355 QLFKQHAFGKEVPNENFEKL-SLEVVNYAKGLPLALKVWGSLLHNLRLTE 403  

                   WedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgek
                   W+ ++   ++      +  I + L++sYDgL  k q++FL IACf +ge+
  gi|1086263   404 WKSAIEHMKN----NSYSGIIDKLKISYDGLEPKQQEMFLDIACFLRGEE 449  

                   vdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLL
                    dy+ + L+       ++GL +L dKSL+ is+          + MH+L 
  gi|1086263   450 KDYILQILESC-HIGAEYGLRILIDKSLVFISE-------YNQVQMHDLI 491  

                   qqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIs
                   q +G+  IV  Q+    +Pg+R  L  a+e  +V ++nTGt         
  gi|1086263   492 QDMGKY-IVNFQK----DPGERSRLWLAKEVEEVMSNNTGTM-------A 529  

                   lD...tseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                    +   +s  + +l  s  A + M  L+  +  ++s+ ++     
  gi|1086263   530 MEaiwVSSYSSTLRFSNQAVKNMKRLRVFNMGRSSTHYAID    570  

gi|9965103|gb|AAG09951.1|: domain 1 of 1, from 172 to 552: score 265.4, E = 9.4e-75
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                            VG+E   ++   LL+  s d V ++GI G  G GKTT A A
  gi|9965103   172    ------VGLESEVTEVMKLLDVGSHDVVHIIGIHGMGGLGKTTLALA 212  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++ +        F  s+F  n+r                +++ ++  +K
  gi|9965103   213 VHNFIA-----LHFDESCFLQNVR---------------EESNKHG--LK 240  

                   LhLQeqfLSkILnqkDikIh...dHLGvieERLkdqKVLIiLDDVDdleQ
                    hLQ  +LSk+L+ kDi   + ++    i+ RL+ +KVL+iLDDVD+ +Q
  gi|9965103   241 -HLQSILLSKLLGEKDITLTswqEGASMIQHRLQRKKVLLILDDVDKRQQ 289  

                   LdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqI
                   L+A+++   WFGpGSR+I+TT Dk+LLk H+++ t YeV+   +  ALq 
  gi|9965103   290 LKAIVGRPDWFGPGSRVIITTRDKHLLKYHEVERT-YEVKVLNQSAALQL 338  

                   FCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWe
                   +   AF++      +e+   ++V++ a  LPL+L V GS+L  k+  eWe
  gi|9965103   339 LTWNAFKREKIDPSYEDV-LNRVVTYASGLPLALEVIGSNLFEKTVAEWE 387  

                   dmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFN.gekv
                    ++   +        ++I+++L+vs+D+L e+ +  FL IAC F ++e  
  gi|9965103   388 SAMEHYKR----IPSDEIQEILKVSFDALGEEQKNVFLDIACCFKgYEW- 432  

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                   + V   L d      ++   vL++KSL+++s+       ++t+eMH++ q
  gi|9965103   433 TEVDNILRDLYGNCTKHHIGVLVEKSLVKVSC-------CDTVEMHDMIQ 475  

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                    +GRe I r+ s   +ePgK + L  +++I  V+  ++          ++
  gi|9965103   476 DMGRE-IERQRSP--EEPGKCKRLLLPKDIIQVFKIEIICL-------DF 515  

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                    +s  ee++  +e+AF +M NL+ L i +++f++ ++   
  gi|9965103   516 SISDKEETVEWNENAFMKMKNLKILIIRNCKFSKGPN    552  

gi|7484909|pir||T06608: domain 1 of 1, from 182 to 580: score 264.9, E = 1.4e-74
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         ++lVGiE  l++++ LL  +  d V ++GI G  GIGKTT A  
  gi|7484909   182    SGNEGLVGIESRLKNLEKLLSWEDLDTVHIIGIVGMVGIGKTTLADC 228  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L+ +        +F  s+F +n+r                ++   +  + 
  gi|7484909   229 LYGRMR-----GQFDGSCFLTNIR---------------ENSGRSG--LE 256  

                   LhLQeqfLSkILnqkDikIhdHLGvieE....RLkdqKVLIiLDDVDdle
                     LQ+ f S +Ln  D++I    G + E+ ++RLk ++ LI+LDDV+d +
  gi|7484909   257 SLLQKLF-STVLNDRDLEIG-APGNAHErferRLKSKRLLIVLDDVNDEK 304  

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfP..SkeeA
                   Q   L +  +W+  GSRII+TT D +L +        Y   +P+  + eA
  gi|7484909   305 QIRYLMGHCKWYQGGSRIIITTRDSKLIETIKGRK--YV--LPklNDREA 350  

                   LqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkske
                   L+ F + AF  ++P   Fe L ++ V   a   PL+L+VlGS L  ++  
  gi|7484909   351 LKLFSLNAFSNSFPLKEFEGL-TNMVLDYAKGHPLALKVLGSDLCERDDL 399  

                   eWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNge
                   +We  L RL++    + +g+I +vL  sY++L  + +  FL IACfF+ e
  gi|7484909   400 YWEAKLDRLKS----RSHGDIYEVLETSYEELTTEQKNVFLDIACFFRSE 445  

                   kvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnL
                   +vdyV++lL     +DV+   k L+dK+LI  s        d +ieMH++
  gi|7484909   446 NVDYVTSLLNSH-GVDVSGVVKDLVDKCLITLS--------DNRIEMHDM 486  

                   LqqLGReAIVrk.................QsidhdePgKRqF.LvDaeeI
                   Lq +++e I  k ++ + ++ +  +++++Q+       +++++L D+e+I
  gi|7484909   487 LQTMAKE-ISLKvetigirdcrwlsrhgnQC-------QWHIrLWDSEDI 528  

                   cdVLtdnTGtgtrsVlGIslDtseieeelnIsekAFegMrNLqFLriykk
                   cd Lt++ Gt   ++ GI lDts++      s kAF+gM NL++L+iy++
  gi|7484909   529 CDLLTEGLGTD--KIRGIFLDTSKLR-AMRLSAKAFQGMYNLKYLKIYDS 575  

                   sfrddgk<-*
                      ++     
  gi|7484909   576 --HCSRG    580  

gi|7267585|emb|CAB78066.1|: domain 1 of 1, from 181 to 557: score 247.9, E = 1.8e-69
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                       D  +lVG++aH+ekm++LL+ + k eVrM+GI G  GIGKT IA  
  gi|7267585   181    TDLINLVGMDAHMEKMQLLLDKEPKSEVRMIGILGMGGIGKTAIANY 227  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L++q+S     + +  ++F+e  +                + ++      
  gi|7267585   228 LYNQFS-----HEYWAHCFIEDAW----------------NTNDPT---- 252  

                   LhLQeqfLSkILnqkDikIhdHLGv....ieERLkdqKVLIiLDDVDdle
                    hLQ+++LS I n ++ k      ++  +i+  Lk++K ++++D+V++ e
  gi|7267585   253 -HLQRKLLSHICNDENAKLF-TREAgamkIKGILKHKKFFLVIDGVNKAE 300  

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   Q  ALAke +WFGpGS II+TT D+ LL + g+n+ +YeV+    ++ALq
  gi|7267585   301 QVHALAKERSWFGPGSLIIITTRDRGLLNSCGVNN-VYEVKCLDSKDALQ 349  

                   IFCrsAFgQnsPp.dGFeeLeAreVtkLaGnLPLGLrVlGSsLRG.kske
                    F   AFg   Pp +G e L   +   La  LP +L    S+L  + + e
  gi|7267585   350 VFEKFAFGGRNPPfHGSERL-FTRASQLAHGLPYALVAFASHLSEqTTIE 398  

                   eWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNge
                    Wed+L RL+         ++e++Lr sYD+L+  +q+ FL +AC+FNg+
  gi|7267585   399 GWEDELFRLED----YPQKNVEEILRASYDDLDYYEQSVFLQVACLFNGS 444  

                   kvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnL
                      ++ a+L++        + + L  KSL  is+       dg+  MH L
  gi|7267585   445 FLWLIRAFLGKL-----GSRINSLRAKSLLDISN-------DGRLIMHFL 482  

                   LqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGI
                    +q G+e IVr+Qs+  + P + +FL  +eeI+dVL+ n+  +   V  I
  gi|7267585   483 VEQIGKE-IVRQQSN--CIPSEQKFLWKPEEIYDVLARNIFLK--HVVDI 527  

                   slDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                      +  i+++ +I        + L+ L+ +      ++    
  gi|7267585   528 TSKLQLISDVSSI-------THGLKLLHWDAY--PLETL    557  

gi|10178211|dbj|BAB11635.1|: domain 1 of 1, from 194 to 571: score 245.2, E = 1.1e-68
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                            VG++  l+ ++sLL   s d+Vr + I+G  GIGKTT A++
  gi|1017821   194    ------VGLRSRLQHISSLLSIGS-DGVRVIVIYGMGGIGKTTLAKV 233  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    f+ +S     + F+ s F en r+       +S     + +  +     
  gi|1017821   234 AFNEFS-----HLFEGSSFLENFRE-------YS-----KKPEGRT---- 262  

                   LhLQeqfLSkILnqkDikIhdHLG.vieERLkdqKVLIiLDDVDdleQLd
                    hLQ q+LS IL+ +Di+    L ++++ER + ++VL++ DDVDd+ QL 
  gi|1017821   263 -HLQHQLLSDILRRNDIEFK-GLDhAVKERFRSKRVLLVVDDVDDVHQLN 310  

                   ALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIY...eVgfPSkeeALq
                     A +  +FG+GSRII+TT + +LLk+ + +   Y+++e +    +e L+
  gi|1017821   311 SAAIDRDCFGHGSRIIITTRNMHLLKQLRAEGS-YspkELD---GDESLE 356  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    F  +AF+ + Pp  F +  ++eV++ +  LPL+  VlG  L  +s  eW
  gi|1017821   357 LFSWHAFRTSEPPKEFLQH-SEEVVTYCAGLPLAVEVLGAFLIERSIREW 405  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                   e +L  L+       +++I+  L++s+++L  + ++ FL IACfF g + 
  gi|1017821   406 ESTLKLLKR----IPNDNIQAKLQISFNALTIEQKDVFLDIACFFIGVDS 451  

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                    yV   L    nL   + L  L +++LI is  gn+      i MH+LL+
  gi|1017821   452 YYVACILDGC-NLYPDIVLSLLMERCLITIS--GNN------IMMHDLLR 492  

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                    +GR+ IVr+ s   ++ g+R  L   ++   VL  ++Gt   ++ G sl
  gi|1017821   493 DMGRQ-IVREISP--KKCGERSRLWSHNDVVGVLKKKSGTN--AIEGLSL 537  

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                     + ++   + + +AF +M  L+ L+      +  g    
  gi|1017821   538 KADVMD-FQYFEVEAFAKMQELRLLELRYV--DLNGS    571  

gi|9965107|gb|AAG09953.1|AF175398_1: domain 1 of 1, from 16 to 393: score 231.4, E = 1.6e-64
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                            VG+E  +++ k LL+  s+d V MVGI G  GIGKTT A A
  gi|9965107    16    ------VGLESRIQEVKMLLDVGSDDVVHMVGIHGLGGIGKTTLAAA 56   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++ +      + F+  +F en+r           et++     Y     
  gi|9965107    57 IYNSIA-----DHFEALCFLENVR-----------ETSKTHGLQY----- 85   

                   LhLQeqfLSkILnqkD.ikIhdHLGvieERLkdqKVLIiLDDVDdleQLd
                     LQ+++LS+  + +  i + +    i+ RL+++KVL+iLDDVD+ eQL 
  gi|9965107    86 --LQRNLLSETVGEDElIGVKQGISIIQHRLQQKKVLLILDDVDKREQLQ 133  

                   ALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFC
                   AL++    F pGSR+I+TT DkqLL  Hg++ t YeV    +e ALq + 
  gi|9965107   134 ALVGRPDLFCPGSRVIITTRDKQLLACHGVKRT-YEVNELNEEYALQLLS 182  

                   rsAFgQnsPpdGFeeL.eAreVtkLaGnLPLGLrVlGSsLRGkskeeWed
                     AF+       +++  + r Vt  aG LPL+L V GS+L G++ e W  
  gi|9965107   183 WKAFKLEKVNPCYKDVlN-RTVTYSAG-LPLALEVIGSNLSGRNIEQWRS 230  

                   mLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdy
                   +L R +       + +I+++L+vsYD+L e +q+ FL I C   + + + 
  gi|9965107   231 TLDRYKR----IPNKEIQEILKVSYDALEEDEQSVFLDISCCLKEYDLKE 276  

                   VkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqL
                   V + L +     +++   vL +KSLI+is        dg+i  H+L + +
  gi|9965107   277 VQDILRAHYGHCMEHHIRVLLEKSLIKIS--------DGYITLHDLIEDM 318  

                   GReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDt
                   G+e IVrk+s   +ePgKR  L    +I        Gt+   +  I  D 
  gi|9965107   319 GKE-IVRKESP--REPGKRSRLWLHTDIIQ------GTS--QIEIICTDF 357  

                   seiee.elnIsekAFegMrNLqFLriykksfrddgk<-*
                   s  ee e+  + +AF++M NL+ L i++  f + +k   
  gi|9965107   358 SLFEEvEIEWDANAFKKMENLKTLIIKNGHFTKGPK    393  

gi|12003378|gb|AAG43546.1|AF211528_1: domain 1 of 1, from 186 to 535: score 211.5, E = 1.5e-58
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                          ++VGi+ Hlek++sLL     ++Vr+ G wG  G+GKTTIARA
  gi|1200337   186    ----NIVGIDTHLEKIESLLEIGI-NDVRIMGMWGMGGVGKTTIARA 227  

                   LfsqLSerhFq.ssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGm
                   +f+ L  r   + +F   +F   ++++ +         r      +s   
  gi|1200337   228 MFDTLLGRRDSsYQFDGACFLKDIKENKH---------RM-----HS--- 260  

                   KLhLQeqfLSkILnqk.DikIhdHLGv..ieERLkdqKVLIiLDDVDdle
                      LQ+ +LS +L+ k + k +   G +++  RL+ +KVLI+LDD+Dd +
  gi|1200337   261 ---LQNILLSNLLREKaNYKNE-EDGKhqMASRLRSKKVLIVLDDIDDKD 306  

                   .QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeAL
                   + L+ LA++  WFG+GSRIIVTT Dk+L    ++   IYeV    ++e  
  gi|1200337   307 hYLEYLAGDLDWFGNGSRIIVTTRDKHLIGKNDV---IYEVTALPDHESI 353  

                   qIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskee
                   q F ++AF++  P + F+eL + eV++    LPL+L VlGSsL  ++   
  gi|1200337   354 QLFYQHAFKKEDPDECFKEL-SLEVVNYTKGLPLALGVLGSSLYNRDITV 402  

                   WedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgek
                   W+ ++   ++      + kI + L++sYDgL +  q++FL IACfF+g+k
  gi|1200337   403 WKSAIEQMKN----NPNSKIVEKLKISYDGLESTQQEIFLDIACFFRGKK 448  

                   vdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLL
                    d++ + L        ++GL vL +KSL+ i++       dg ieMH+L 
  gi|1200337   449 KDDIMQVLKSC-HFGAEYGLDVLIEKSLVFITE-------DGEIEMHDLI 490  

                   qqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIs
                   q++GR  IV  Q+    + gK   L  a++  +V  +nT  +        
  gi|1200337   491 QEMGRY-IVNLQK----DLGKCSRLWLAKDFEEVMINNTVRK-------- 527  

                   lDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   l+   +                               +   
  gi|1200337   528 LNYAIML------------------------------N    535  

gi|9965105|gb|AAG09952.1|AF175389_1: domain 1 of 1, from 126 to 512: score 209.8, E = 5e-58
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                            VG++    + + LL+   +d+V M GI G  G+GK+T AR 
  gi|9965105   126    ------VGLGSKVLEVRKLLDVGRDDGVHMLGIHGIDGVGKSTLARE 166  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    +++L +    + F  s+F+en+r+          ++ ++gl+       
  gi|9965105   167 VYNKLIS----DHFDASCFIENVRE----------KSKKHGLH------- 195  

                   LhLQeqfLSkILnqkDikIhdHLGvieE.......RLkdqKVLIiLDDVD
                    hLQ+ +LSkIL+ kDi       + +E +  +++RL+++KVL +LDDVD
  gi|9965105   196 -HLQNILLSKILGEKDINLT---SAQQEismmqrhRLQQKKVLMVLDDVD 241  

                   dleQLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkee
                     eQL A  ++  WFGpGS +I+TT+DkqLL +++In t YeV+   k++
  gi|9965105   242 RPEQLQAVTGKPAWFGPGSKVIITTQDKQLLTSYDINRT-YEVKKLNKDD 290  

                   ALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGksk
                   ALq +   AF+       +++L  ++ ++ a +LPL L +l S+L Gks 
  gi|9965105   291 ALQLLKWKAFKMHYFDPRYKML-LNRAVTFASSLPLTLEILASYLFGKSV 339  

                   eeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFN.
                   +eW+ + + +      s +   e +L+v +D+L ek+++  L IAC F +
  gi|9965105   340 KEWKFTFHQFVR----SPNNPMEMILKVIFDSLKEKEKSVLLDIACYFKg 385  

                   gekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMH
                   +e  + V + L +     +++   vL+dKSL+ i+ +++    ++ti MH
  gi|9965105   386 YEL-TEVQDILHAHYGQCMKYYIDVLVDKSLVYITHGTEP--CNDTITMH 432  

                   nLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVl
                    L    ++e IVr +s    +Pg+ + L   e+ ++V++           
  gi|9965105   433 ELI---AKE-IVRLESM-MTKPGECRRLWSWEDVREVFSKIEI------- 470  

                   GIslD..tseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                    I lD ++   ee +  +   F+ M NL+ L i +  f++ ++   
  gi|9965105   471 -ICLDypIFDEEEIVQWDGTTFQNMQNLKTLIIRNGNFSKGPE    512  

gi|12056930|gb|AAG48133.1|AF322633_1: domain 1 of 1, from 182 to 522: score 208.3, E = 1.5e-57
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      +  +  VG+   + +++ LL+  s  +V  +GI+G  GIGKTT ARA
  gi|1205693   182    KKINRPVGLQYRMLELNGLLDAASLSGVHLIGIYGVGGIGKTTLARA 228  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L++         +F   +F + +r++            ++gl        
  gi|1205693   229 LYDSVA-----VQFDALCFLDEVRENA----------MKHGLV------- 256  

                   LhLQeqfLSkILnqkDikIh....dHLGvieERLkdqKVLIiLDDVDdle
                    hLQ+  L++  + kDi+ ++ +++    +++RL+ ++VL++LDD++ +e
  gi|1205693   257 -HLQQTILAETVGEKDIRLPsvkqG-ITLLKQRLQEKRVLLVLDDINESE 304  

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   QL+AL++   WFGpGSR+I+TT D+qLL++Hg++  IYeV+   ++eAL+
  gi|1205693   305 QLKALVGSPGWFGPGSRVIITTRDRQLLESHGVEK-IYEVENLADGEALE 353  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    +C  AF+ +  + +F +   ++  + a  LPL+L V GS+L G+   eW
  gi|1205693   354 LLCWKAFKTDKVYPDFINK-IYRALTYASGLPLALEVIGSNLFGREIVEW 402  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                     +L   ++      D +I+k+L++s+D+L+e++++LFL IACfF g+k 
  gi|1205693   403 QYTLDLYEK----IHDKDIQKILKISFDALDEHEKDLFLDIACFFKGCKL 448  

                   dyVkalL....adsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMH
                     V++  +++ +ds     +    vL +K LI+i++        g+++MH
  gi|1205693   449 AQVESIVsgryGDS----LKAIIDVLLEKTLIKIDE-------HGRVKMH 487  

                   nLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVl
                   +L qq+GRe IVr++s   + Pg    L  +e+  dVL            
  gi|1205693   488 DLIQQMGRE-IVRQESP--KHPGNCSRLWSPEDVADVL------------ 522  

                   GIslDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                               
  gi|1205693     - -----------------------------------------    -    

gi|7267578|emb|CAB78059.1|: domain 1 of 1, from 1 to 336: score 201.3, E = 1.8e-55
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                              ++  +e+++ LL  +s++eVrM+GIwG  GIGKTTIA+ 
  gi|7267578     1    --------MDVDMERLNPLLSIESENEVRMIGIWGMGGIGKTTIAKC 39   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L+   S     ++F + +F+en+r               ++   Y     
  gi|7267578    40 LYEEYS-----RRFVHYCFIENVR------------IFAKNGLPY----- 67   

                   LhLQeqfLSkILnqkD...ikIhdHLGvieERLkdqKVLIiLDDVDdleQ
                     LQe++LS+I ++k ++   ++  +  i+  Lk +  +++LDDVD+++Q
  gi|7267578    68 --LQEKLLSEIRGKKQetlWSVEKGCRLIKSKLKEKN-FLVLDDVDNVDQ 114  

                   LdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqI
                   L ALAket+WFGpGSRII+TT D  LL ++g+ +  Y V+f  + +A + 
  gi|7267578   115 LHALAKETSWFGPGSRIIITTRDFGLLYSFGVRL-LYRVSFLDDNDAIKV 163  

                   FCrsAFgQnsPp.dGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                   F   AF   +Pp d + +  +++  +La  LP +L   G           
  gi|7267578   164 FKHVAFDGGQPPfDVYHQF-SVRASRLAQGLPSALEAFG----------- 201  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                     +L  L+t        +I ++L+ sYDgL+e++qa FLh+AC+FNg  v
  gi|7267578   202 --ALGILET----VPQKRIKDILKTSYDGLDEEEQAAFLHVACLFNGDSV 245  

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                   ++V al+ d        + k L  KSLI is       +dg+i  H L +
  gi|7267578   246 HRVNALIDDG-----DMRIKALEVKSLIDIS-------LDGCITLHVLIE 283  

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                   q +Re I                               +t    V G  l
  gi|7267578   284 QAARE-I-------------------------------DTA--MVEGVAL 299  

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   +++e+ ++l I+ + +  + NL+F + +++++    k   
  gi|7267578   300 HMCEMIHVLPIDGNILNTINNLKFFKAFTHIEVMNSK    336  

gi|7484912|pir||T06144: domain 1 of 1, from 197 to 575: score 199.2, E = 8.1e-55
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         ddl GiE   ++++ LL +d+++ Vr VG+ G  GIGKTT A +
  gi|7484912   197    ---DDLPGIESRSKELEKLLMFDNDECVRVVGVLGMTGIGKTTVADI 240  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    + q +      +F    F e +                 ++  Y+    
  gi|7484912   241 VYKQNF-----QRFDGYEFLEDIE---------------DNSKRYG---- 266  

                   L.hLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLd
                   L+ L +++L k+L+ +++ ++   G  e+ L+++K +I+LD V   +Q +
  gi|7484912   267 LpYLYQKLLHKLLDGENVDVR-AQGRPENFLRNKKLFIVLDNVTEEKQIE 315  

                   ALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFC
                    L ++ + +  GSRI+++T Dk+LL+    + t Y V    + eA++ FC
  gi|7484912   316 YLIGKKNVYRQGSRIVIITRDKKLLQKNA-DAT-YVVPRLNDREAMELFC 363  

                   rsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedm
                   +  Fg   P + F +L ++ ++  a  LPL+L+ lG  L   + ++W++ 
  gi|7484912   364 LQVFGNHYPTEEFVDL-SNDFVCYAKGLPLALKLLGKGLLTHDINYWKKK 412  

                   LpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyV
                   L  L+       D + +k L+ sY +L++  ++ FL IACfF+ ek+d V
  gi|7484912   413 LEFLQV----NPDKELQKELKSSYKALDDDQKSVFLDIACFFRSEKADFV 458  

                   kalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLG
                    + L  + + D +     L +K+L+ is         ++ieMH+LL  +G
  gi|7484912   459 SSILKSD-DIDAKDVMRELEEKCLVTIS--------YDRIEMHDLLHAMG 499  

                   ReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDts
                   +e I  ++si  ++ g+R+ L + ++I+d+L++nTGt+   V GI l++s
  gi|7484912   500 KE-IGKEKSI--RKAGERRRLWNHKDIRDILEHNTGTE--CVRGIFLNMS 544  

                   eieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   e+   +     AF  ++ L+FL+++ +   +++    
  gi|7484912   545 EVR-RIKLFPAAFTMLSKLKFLKFHSS--HCSQW    575  

gi|3947733|emb|CAA08797.1|: domain 1 of 1, from 194 to 533: score 174.4, E = 2.3e-47
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         +  VGi+ Hl++ ksLL ++s  +Vr+ GIwG  G+GKTT ARA
  gi|3947733   194    SSSEYTVGIDTHLKEVKSLLEMES-GDVRILGIWGMGGVGKTTLARA 239  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    f+ LS      +Fq   F en+++               +++e      
  gi|3947733   240 VFDTLS-----PRFQYASFLENVKE--------------TNINE------ 264  

                   LhLQeqfLSkIL....nqkDikIhdHLGvieERLkdqKVLIiLDDVDdle
                      Q+++LS++L++++++ D k +     +  RL+ +KVLI+LDD+++ +
  gi|3947733   265 --IQNKLLSELLredkKHVDNKTE-GKRLMAKRLRFMKVLIVLDDINHCD 311  

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                    L+ LA++  WFG+GSRII TT ++++L   ++ h   +V    + +A q
  gi|3947733   312 HLEYLAGDLCWFGSGSRIIATTRNREILGMNNVVH---QVTTLLEPDAIQ 358  

                   IFCrsAFgQnsPp.dGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskee
                    F  +AF+  + p++  ++L A e + +a  LPL+L+  G  L  k+k  
  gi|3947733   359 LFNHYAFKGLFSPdEHMKKL-ALEAVSHAKGLPLALKLWGIWLNNKDKTL 407  

                   WedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgek
                   W ++   +r        +++ + L++s++gL +k++ +FL IACfF+g+ 
  gi|3947733   408 WREAVDMIRR----ESSEDVVNNLKISFEGLQDKEKTIFLDIACFFRGMR 453  

                   vdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLL
                    d+  + L    +LD  ++L+   +KSL++is+        +t  MH+L 
  gi|3947733   454 KDKTIEILKSY-DLDAHIRLHGIIEKSLVSISE-------YETLQMHDLI 495  

                   qqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIs
                   q +GR  +V +Q+      g R    + e+  dV  d  G g        
  gi|3947733   496 QDMGRY-VVKEQK------GSRSRVWNVEDFEDVMMDSMGQG-------- 530  

                   lDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                k+      k   
  gi|3947733   531 -----------------------------KW------K    533  

gi|7488375|pir||T04583: domain 2 of 2, from 580 to 973: score 172.4, E = 9.2e-47
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                          + +Gi   l +m+ LLc     +Vr +GIwG +GIGKTT A+A
  gi|7488375   580    ----EQIGINSRLLEMEHLLCKQP-WGVRRIGIWGMPGIGKTTLAKA 621  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    f+q+S       ++ s+F+            +Sg    +gl+       
  gi|7488375   622 FFDQIS-----GGYEASCFIKHFD------KAFSG----KGLHR------ 650  

                   LhLQeqfLSkILnqkDik...IhdHLGvieERLkdqKVLIiLDDVDdleQ
                     L+e+f  kIL+      ++I       ++ L  ++ L++LDDV +  +
  gi|7488375   651 -LLEEHF-GKILKELPRVcssIT-RPSLPRDKLSKKRTLVVLDDVHNPLV 697  

                   LdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqI
                    +      +WFGpGS II+T  Dkq ++   Inh +YeV    + eALq 
  gi|7488375   698 AESFLEGFHWFGPGSLIIITSRDKQVFRLCQINH-VYEVQSFNENEALQL 746  

                   FCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWe
                   F ++AF+++       eL + +V+  a   PL+L+     L+Gk   e e
  gi|7488375   747 FSQCAFRRDINEQNLLEL-SLKVIDYASGNPLALSFYCRVLKGKELSEME 795  

                   dmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvd
                    +   L+     +   kI +  + sY+ L+++++ +FL IACfF ge+vd
  gi|7488375   796 TTFFKLKQ----RTPYKIFDLFKSSYETLDDNEKNIFLDIACFFSGENVD 841  

                   yVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqq
                   yV  lL+        +G  vL++ +L+ is        + +++MH+  q 
  gi|7488375   842 YVMRLLEGC-GFFPHVGIDVLVENCLVTIS--------ENRVKMHRIIQD 882  

                   LGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnT.............
                   +GRe I+  + +   + + R+ L D+  I   L+d+  + +++++ + ++
  gi|7488375   883 FGRE-IIDGETV---QIERRRRLSDPWSIKFLLEDDEleanedpkatytr 928  

                   ..GtgtrsVlGIslDtseieeelnIsekAFegMrNLqFLriykksfrddg
                   + Gt+   + GI lDts++   +++   AFe M  L+FL+iy++  ++++
  gi|7488375   929 tlGTE--DIEGILLDTSNLT--FDVKPGAFENMLSLRFLKIYCS--SYEN 972  

                   k<-*
                   +   
  gi|7488375   973 H    973  

gi|7488903|pir||T18548: domain 1 of 1, from 250 to 644: score 166.2, E = 6.9e-45
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         d+lVGi++H e +  +L Ldsk  V MVG +G  GIGKTT A+A
  gi|7488903   250    ---DELVGIDDHVEVILEMLSLDSK-SVTMVGLYGMGGIGKTTTAKA 292  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++++S     s F   +F++n+r               a+    +    
  gi|7488903   293 VYNKIS-----SHFDRCCFVDNVR---------------AMQEQKD--GI 320  

                   LhLQeqfLSkILnqkDikIhdHLG...vieERLkdqKVLIiLDDVD.dle
                     LQ+++ S+IL+++ +   ++ G+++ i+ER    K L++LDDVD++ +
  gi|7488903   321 FILQKKLVSEILRMDSVGFTNDSGgrkMIKERVSKSKILVVLDDVDeKFK 370  

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInht.IYeVgfPSkeeAL
                   + d L    + F +G R I+T  ++  L   + n  + YeVg  S+++ L
  gi|7488903   371 FEDILGC-PKDFDSGTRFIITSRNQNVLSRLNENQCkLYEVGSMSEQHSL 419  

                   qIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskee
                   + F  +AF++n+Pp ++e L A+ ++   G LPL L+V GS L +     
  gi|7488903   420 ELFSKHAFKKNTPPSDYETL-ANDIVSTTGGLPLTLKVTGSFLFRQEIGV 468  

                   WedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgek
                   Wed+L  Lr+     LD+ + + L++sYD+L  + +++FL IACfF g++
  gi|7488903   469 WEDTLEQLRK--TLDLDE-VYDRLKISYDALKAEAKEIFLDIACFFIGRN 515  

                   vdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLL
                    +    +  +  +   +     L +++ I++ +       dg  eMH+ L
  gi|7488903   516 KEMPYYMWSEC-KFYPKSNIIFLIQRCMIQVGD-------DGVLEMHDQL 557  

                   qqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIs
                   + +GRe IVr++ +  + P+KR      ee  d L +++G++   V  Is
  gi|7488903   558 RDMGRE-IVRREDV--QRPWKRSRIWSREEGIDLLLNKKGSS--QVKAIS 602  

                   lD...tseieeelnIsekA..FegMrNLqFLriykksfrddgk<-*
                     ++ ++  e  +  + k++ F  ++ L+   +  + +  +g    
  gi|7488903   603 IPnnmLYAWESGVKYEFKSecFLNLSELRLFFVGST-TLLTGD    644  

gi|10177497|dbj|BAB10888.1|: domain 1 of 1, from 141 to 534: score 165.1, E = 1.4e-44
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                          + +Gi   l +++ +       + r VGIwG +GIGKTT A+A
  gi|1017749   141    ----ERIGIYSKLLEIEKMINKQP-LDIRCVGIWGMPGIGKTTLAKA 182  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    f+q S       F  ++F+e                +++ + e +  + 
  gi|1017749   183 VFDQMS-----GEFDAHCFIE---------------DYTKAIQEKG--VY 210  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                     L+eqfL +  +  +      L  +++RL++++VL++LDDV    + + 
  gi|1017749   211 CLLEEQFLKENAGASGTVTK--LSLLRDRLNNKRVLVVLDDVRSPLVVES 258  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                     +   WFGp S II+T +Dk  ++  ++n  IYeV    ++eALq F +
  gi|1017749   259 FLGGFDWFGPKSLIIITSKDKSVFRLCRVNQ-IYEVQGLNEKEALQLFSL 307  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGksk.eeWedm
                   +A   + +     e  + +V+k a   PL+L+  G  L Gk+ + e e +
  gi|1017749   308 CASIDDMAEQNLHEV-SMKVIKYANGHPLALNLYGRELMGKKRpPEMEIA 356  

                   LpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyV
                      L+     +      +  + sYD L+++++ +FL IACfF ge+vdyV
  gi|1017749   357 FLKLKE----CPPAIFVDAIKSSYDTLNDREKNIFLDIACFFQGENVDYV 402  

                   kalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLG
                    +lL+        +G  vL++KSL+ is        + +++MHnL q +G
  gi|1017749   403 MQLLEGC-GFFPHVGIDVLVEKSLVTIS--------ENRVRMHNLIQDVG 443  

                   ReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgt...........
                   R+ I+ ++    ++   R  L ++  I + L+d+  ++ ++++++ ++ +
  gi|1017749   444 RQ-IINRET---RQTKRRSRLWEPCSIKYLLEDKEQNENeeqkttferaq 489  

                   ..rsVlGIslDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                    ++ + G+ lDts+++  ++I   AF+ M NL+  +iy +    +     
  gi|1017749   490 vpEEIEGMFLDTSNLS--FDIKHVAFDNMLNLRLFKIYSSNPEVHHV    534  

gi|10121909|gb|AAG13419.1|AC000348_16: domain 1 of 1, from 393 to 759: score 165.1, E = 1.4e-44
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         d  VG+E  ++ +  L   +s  +    G +G  GIGKTT A+A
  gi|1012190   393    --ADYTVGLESPIKDLMKLFNTESSSGIQVMGLYGMGGIGKTTLAKA 437  

                   LfsqLSerhFqssF.qlsaFmenlrgsyskeeigSgetrpaglDeYsyGm
                    ++++       +F+++++F+e +rg        S  +   gl +    +
  gi|1012190   438 FYNKII-----VNFnRHRVFIESVRG-------KS--SDQDGLVN----L 469  

                   KLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLd
                   +  L +++   +   +D+ I   L  i+E  + +K  ++LDDVD+++Q  
  gi|1012190   470 QKTLIKELFRLVPEIEDVSIG--LEKIKENVHEKKIIVVLDDVDHIDQVN 517  

                   ALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFC
                   AL++et+W+G GS I++TT D ++L    +n + YeV+  ++  AL+ F 
  gi|1012190   518 ALVGETSWYGEGSLIVITTRDSEILSKLSVNQQ-YEVKCLTEPQALKLFS 566  

                   rsAFgQnsPp.dGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWed
                    +  ++  Pp+ G  eL ++++++  G LPL+ +V GS++  k+++eW  
  gi|1012190   567 FYSLRKEKPPtQGLLEL-SKKIAEVTGLLPLAVKVFGSHFYDKDENEWQV 615  

                   mLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdy
                   +L  L+t   + L+g    vL  s+ +L+e+++ +FL IAC+F ++++++
  gi|1012190   616 ELEKLKT-QQDKLHG----VLALSFKSLDEEEKKIFLDIACLFLKMDITK 660  

                   ..VkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                   ++V + L     L+ +  L vL +KSL  i +       d+t  MH+  +
  gi|1012190   661 eeVVDILKGC-GLNAEAALRVLIQKSLLTILT-------DDTLWMHDQIR 702  

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                    +GR+  V+k+s d  +P+ R  L D  eI +VL++ +Gt+  s+ GI l
  gi|1012190   703 DMGRQ-MVHKESSD--DPEMRSRLWDRGEIMNVLDYMKGTS--SIRGIVL 747  

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   D                         ++kk  rd++    
  gi|1012190   748 D-------------------------FNKKFARDHTA    759  

gi|12321343|gb|AAG50739.1|AC079733_7: domain 1 of 1, from 9 to 302: score 162.6, E = 8.3e-44
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                             s  +V +                 
  gi|1232134     9    -----------------------S-GAVNI----------------- 14   

                   LfsqLSerhFq.ssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGm
                     s  S   +  s+++l+  m++l                + +De +   
  gi|1232134    15 --SNTS--NYTlSDYILTRRMYKLI------------FFFVRVDETD--- 45   

                   KLhLQeqfLSkILnqkDikIhdHLGv.ieERLkdqKVLIiLDDVDdleQL
                                     +I+ +  + i  R ++  V      ++d++  
  gi|1232134    46 ------------------MIE-NIAAyISSRFQNSAV------IEDIK-- 68   

                   dALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIF
                       +                              Y  + P  +e LqIF
  gi|1232134    69 ----G----------------------------S-YP-K-PRFDEDLQIF 83   

                   CrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWed
                   C +AF Q++P dGF eL Are+t ++G+LPLGL+V GS++RG ske W  
  gi|1232134    84 CKYAFNQKTPEDGFDEL-AREITYHVGELPLGLKVIGSHFRGLSKEQWPM 132  

                   mLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdy
                   +  RLrt      +g+Ie +L++sYD+L+++D++LFLhIACfFN ek+++
  gi|1232134   133 EVSRLRT----YRNGDIERILKFSYDALCDEDKDLFLHIACFFNMEKITK 178  

                   VkalLadsnnLDVrqGLkvLadKSLIhisplgned.kvdgtieMHnLLqq
                   Vk+l ++  + D rq L++L  KSLI+i+ ++ ed++  + i M nLL+q
  gi|1232134   179 VKELFGHR-FKDLRQSLHILEMKSLISIEHTDLEDsEYYESINMRNLLVQ 227  

                   LGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslD
                   LG e IVrk+s+   ePg+R+FL+D ++Ic V + +T     sV GI+  
  gi|1232134   228 LGQE-IVRKESV--LEPGQRRFLIDYKDICAVVSGHTTIT-GSVVGID-- 271  

                   tseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                    s++   l+I ek+F+gM+NLqFLr++++   ++++   
  gi|1232134   272 -SKNW--LSITEKSFKGMSNLQFLRVKND--LYHPN    302  

gi|4588054|gb|AAD25968.1|AF093641_2: domain 1 of 1, from 235 to 620: score 159.9, E = 5.4e-43
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         d+lVGi++H+++    L Lds + V MVG +G  GIGKTT A+A
  gi|4588054   235    ---DELVGIDDHITAVLEKLSLDS-ENVTMVGLYGMGGIGKTTTAKA 277  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++++S     s F   +F++n+r+++           + g+        
  gi|4588054   278 VYNKIS-----SCFDCCCFIDNIRETQ----------EKDGVVV------ 306  

                   LhLQeqfLSkILnqkDikIhdHLGv...........ieERLkdqKVLIiL
                     LQ+++ S+IL+     I+    v+ +++++++++i+ER    K L++L
  gi|4588054   307 --LQKKLVSEILR-----ID-SGSVgfnndsggrktIKERVSRFKILVVL 348  

                   DDVDdleQLdALAketqWFGpGSRIIVTTeDkqLLkaHgInht.IYeVgf
                   DDVD     + + +  + F + SR I+T      L   + n  + YeVg 
  gi|4588054   349 DDVDEKFKFEDMLGSPKDFISQSRFIITSRSMRVLGTLNENQCkLYEVGS 398  

                   PSkeeALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsL
                    Sk   L+ F  +AF++n+Pp  +e L A+ V+     LPL L+V GS L
  gi|4588054   399 MSKPRSLELFSKHAFKKNTPPSYYETL-ANDVVDTTAGLPLTLKVIGSLL 447  

                   RGkskeeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIA
                          Wed+L  Lr      LD+ + + L++sYD+L+ + +++FL IA
  gi|4588054   448 FKQEIAVWEDTLEQLRR--TLNLDE-VYDRLKISYDALNPEAKEIFLDIA 494  

                   CfFNgekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgt
                   CfF g++ +    +  d  n         L +++ I++ +       d+ 
  gi|4588054   495 CFFIGQNKEEPYYMWTDC-NFYPASNIIFLIQRCMIQVGD-------DDE 536  

                   ieMHnLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgt
                    +MH+ L+ +GRe IVr++ +    P+KR     aee  d L +++G++ 
  gi|4588054   537 FKMHDQLRDMGRE-IVRREDV---LPWKRSRIWSAEEGIDLLLNKKGSS- 581  

                   rsVlGIslDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                    +V  Is   ++++ e+    + F  ++ L++L+  +   + +g    
  gi|4588054   582 -KVKAISIP-WGVKYEFKS--ECFLNLSELRYLHASEA--MLTGD    620  

gi|7488902|pir||T18547: domain 1 of 1, from 235 to 620: score 159.4, E = 7.6e-43
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         d+lVGi++H+++    L Lds + V MVG +G  GIGKTT A+A
  gi|7488902   235    ---DELVGIDDHITAVLEKLSLDS-ENVTMVGLYGMGGIGKTTTAKA 277  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++++S     s F   +F++n+r+++           + g+        
  gi|7488902   278 VYNKIS-----SCFDCCCFIDNIRETQ----------EKDGVVV------ 306  

                   LhLQeqfLSkILnqkDikIhdHLGv...........ieERLkdqKVLIiL
                     LQ+++ S+IL+     I+    v+ +++++++++i+ER    K L++L
  gi|7488902   307 --LQKKLVSEILR-----ID-SGSVgfnndsggrktIKERVSRFKILVVL 348  

                   DDVDdleQLdALAketqWFGpGSRIIVTTeDkqLLkaHgInht.IYeVgf
                   DDVD     + + +  + F + SR I+T      L   + n  + YeVg 
  gi|7488902   349 DDVDEKFKFEDMLGSPKDFISQSRFIITSRSMRVLGTLNENQCkLYEVGS 398  

                   PSkeeALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsL
                    Sk   L+ F  +AF++n+Pp  +e L A+ V+     LPL L+V GS L
  gi|7488902   399 MSKPRSLELFSKHAFKKNTPPSYYETL-ANDVVDTTAGLPLTLKVIGSLL 447  

                   RGkskeeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIA
                          Wed+L  Lr      LD+ + + L++sYD+L+ + +++FL IA
  gi|7488902   448 FKQEIAVWEDTLEQLRR--TLNLDE-VYDRLKISYDALNPEAKEIFLDIA 494  

                   CfFNgekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgt
                   CfF g++ +    +  d  n         L +++ I++ +       d+ 
  gi|7488902   495 CFFIGQNKEEPYYMWTDC-NFYPASNIIFLIQRCMIQVGD-------DDE 536  

                   ieMHnLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgt
                    +MH+ L+ +GRe IVr++ +    P+KR     aee  d L +++G++ 
  gi|7488902   537 FKMHDQLRDMGRE-IVRREDV---LPWKRSRIWSAEEGIDLLLNKKGSS- 581  

                   rsVlGIslDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                    +V  Is   ++++ e+    + F  ++ L++L+  +   + +g    
  gi|7488902   582 -KVKAISIP-WGVKYEFKS--ECFLNLSELRYLHAREA--MLTGD    620  

gi|7488901|pir||T18546: domain 1 of 1, from 235 to 620: score 159.4, E = 7.6e-43
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         d+lVGi++H+++    L Lds + V MVG +G  GIGKTT A+A
  gi|7488901   235    ---DELVGIDDHITAVLEKLSLDS-ENVTMVGLYGMGGIGKTTTAKA 277  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++++S     s F   +F++n+r+++           + g+        
  gi|7488901   278 VYNKIS-----SCFDCCCFIDNIRETQ----------EKDGVVV------ 306  

                   LhLQeqfLSkILnqkDikIhdHLGv...........ieERLkdqKVLIiL
                     LQ+++ S+IL+     I+    v+ +++++++++i+ER    K L++L
  gi|7488901   307 --LQKKLVSEILR-----ID-SGSVgfnndsggrktIKERVSRFKILVVL 348  

                   DDVDdleQLdALAketqWFGpGSRIIVTTeDkqLLkaHgInht.IYeVgf
                   DDVD     + + +  + F + SR I+T      L   + n  + YeVg 
  gi|7488901   349 DDVDEKFKFEDMLGSPKDFISQSRFIITSRSMRVLGTLNENQCkLYEVGS 398  

                   PSkeeALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsL
                    Sk   L+ F  +AF++n+Pp  +e L A+ V+     LPL L+V GS L
  gi|7488901   399 MSKPRSLELFSKHAFKKNTPPSYYETL-ANDVVDTTAGLPLTLKVIGSLL 447  

                   RGkskeeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIA
                          Wed+L  Lr      LD+ + + L++sYD+L+ + +++FL IA
  gi|7488901   448 FKQEIAVWEDTLEQLRR--TLNLDE-VYDRLKISYDALNPEAKEIFLDIA 494  

                   CfFNgekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgt
                   CfF g++ +    +  d  n         L +++ I++ +       d+ 
  gi|7488901   495 CFFIGQNKEEPYYMWTDC-NFYPASNIIFLIQRCMIQVGD-------DDE 536  

                   ieMHnLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgt
                    +MH+ L+ +GRe IVr++ +    P+KR     aee  d L +++G++ 
  gi|7488901   537 FKMHDQLRDMGRE-IVRREDV---LPWKRSRIWSAEEGIDLLLNKKGSS- 581  

                   rsVlGIslDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                    +V  Is   ++++ e+    + F  ++ L++L+  +   + +g    
  gi|7488901   582 -KVKAISIP-WGVKYEFKS--ECFLNLSELRYLHAREA--MLTGD    620  

gi|4588064|gb|AAD25973.1|AF093646_1: domain 1 of 1, from 235 to 620: score 159.4, E = 7.6e-43
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         d+lVGi++H+++    L Lds + V MVG +G  GIGKTT A+A
  gi|4588064   235    ---DELVGIDDHITAVLEKLSLDS-ENVTMVGLYGMGGIGKTTTAKA 277  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++++S     s F   +F++n+r+++           + g+        
  gi|4588064   278 VYNKIS-----SCFDCCCFIDNIRETQ----------EKDGVVV------ 306  

                   LhLQeqfLSkILnqkDikIhdHLGv...........ieERLkdqKVLIiL
                     LQ+++ S+IL+     I+    v+ +++++++++i+ER    K L++L
  gi|4588064   307 --LQKKLVSEILR-----ID-SGSVgfnndsggrktIKERVSRFKILVVL 348  

                   DDVDdleQLdALAketqWFGpGSRIIVTTeDkqLLkaHgInht.IYeVgf
                   DDVD     + + +  + F + SR I+T      L   + n  + YeVg 
  gi|4588064   349 DDVDEKFKFEDMLGSPKDFISQSRFIITSRSMRVLGTLNENQCkLYEVGS 398  

                   PSkeeALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsL
                    Sk   L+ F  +AF++n+Pp  +e L A+ V+     LPL L+V GS L
  gi|4588064   399 MSKPRSLELFSKHAFKKNTPPSYYETL-ANDVVDTTAGLPLTLKVIGSLL 447  

                   RGkskeeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIA
                          Wed+L  Lr      LD+ + + L++sYD+L+ + +++FL IA
  gi|4588064   448 FKQEIAVWEDTLEQLRR--TLNLDE-VYDRLKISYDALNPEAKEIFLDIA 494  

                   CfFNgekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgt
                   CfF g++ +    +  d  n         L +++ I++ +       d+ 
  gi|4588064   495 CFFIGQNKEEPYYMWTDC-NFYPASNIIFLIQRCMIQVGD-------DDE 536  

                   ieMHnLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgt
                    +MH+ L+ +GRe IVr++ +    P+KR     aee  d L +++G++ 
  gi|4588064   537 FKMHDQLRDMGRE-IVRREDV---LPWKRSRIWSAEEGIDLLLNKKGSS- 581  

                   rsVlGIslDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                    +V  Is   ++++ e+    + F  ++ L++L+  +   + +g    
  gi|4588064   582 -KVKAISIP-WGVKYEFKS--ECFLNLSELRYLHAREA--MLTGD    620  

gi|4588048|gb|AAD25965.1|AF093638_1: domain 1 of 1, from 235 to 628: score 157.9, E = 2.2e-42
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         d+lVGi++H+++    L Lds + V MVG +G  GIGKTT A+A
  gi|4588048   235    ---DELVGIDDHITAVLEKLSLDS-ENVTMVGLYGMGGIGKTTTAKA 277  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++++S     s F   +F++n+r++++          + g+        
  gi|4588048   278 VYNKIS-----SCFDRCCFIDNIRETQD---------QKDGVVV------ 307  

                   LhLQeqfLSkILnqkDikIhdHLGv...........ieERLkdqKVLIiL
                     LQ+++ S+IL+     I+    v+ +++++++++i+ER    K L++L
  gi|4588048   308 --LQKKLVSEILR-----ID-SGSVgfnndsggrktIKERVSRFKILVVL 349  

                   DDVDdleQLdALAketqWFGpGSRIIVTTeDkqLLkaHgInht.IYeVgf
                   DDVD     + + +  + F + SR I+T      L   + n  + YeVg 
  gi|4588048   350 DDVDEKFKFEDMLGSPKDFISQSRFIITSRSMRVLGTLNENQCkLYEVGS 399  

                   PSkeeALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsL
                    Sk   L+ F  +AF++n+Pp ++e L A+ V+     LPL L+V GS L
  gi|4588048   400 MSKPRSLELFSKHAFKKNTPPSDYETL-ANDVVDTTAGLPLTLKVIGSIL 448  

                   RGkskeeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIA
                          Wed+L  Lr+     LD+ + + L++sYD+L  + +++FL IA
  gi|4588048   449 FKQEIAVWEDTLEQLRK--TLNLDE-VYDRLKISYDALKPEAKEIFLDIA 495  

                   CfFNgekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgt
                   CfF g++ ++   +  d  n         L +++ I++ +       d+ 
  gi|4588048   496 CFFIGKNKEKPYYMWTDC-NFYPASNIIFLIQRCMIQVGD-------DDK 537  

                   ieMHnLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgt
                    +MH+ L+ +GRe IVr++ +    P+KR      ee  d L +++G++ 
  gi|4588048   538 FKMHDQLRDMGRE-IVRREDV---RPWKRSRIWSREEGIDLLLNKKGSS- 582  

                   rsVlGIslDtseieeelnIsekA..FegMrNLqFLriykksfrddgk<-*
                    +V  Is       + +  + k++ F  ++ L++L+    +   d +   
  gi|4588048   583 -KVKAISMVPPLSPDFVKYEFKSecFLNLSELRYLHASSAMLTGDLN    628  

gi|4588066|gb|AAD25974.1|AF093647_1: domain 1 of 1, from 235 to 621: score 156.4, E = 5.9e-42
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         d+lVGi++H+++    L Lds + V MVG +G  GIGKTT A+A
  gi|4588066   235    ---DELVGIDDHITAVLEKLSLDS-ENVTMVGLYGMGGIGKTTTAKA 277  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++++S     s F   +F++n+r++++          + g+        
  gi|4588066   278 VYNKIS-----SCFDRCCFIDNIRETQD---------QKDGVVV------ 307  

                   LhLQeqfLSkILnqkDikIhdHLGv...........ieERLkdqKVLIiL
                     LQ+++ S+IL+     I+    v+ ++++++++ i+ER    K L++L
  gi|4588066   308 --LQKKLVSEILR-----ID-SGSVgfnndsggrkmIKERVSRFKILVVL 349  

                   DDVDdleQLdALAketqWFGpGSRIIVTTeDkqLLkaHgInht.IYeVgf
                   DDVD     + + +  + F + SR I+T      L   + n  + YeVg 
  gi|4588066   350 DDVDEKFKFEDMLGSPKDFISQSRFIITSRSMRVLGTLNENQCkLYEVGS 399  

                   PSkeeALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsL
                    Sk   L+ F  +AF++n+Pp ++e L A+ V+     LPL L+V GS L
  gi|4588066   400 MSKPRSLELFSKHAFKKNTPPSDYETL-ANDVVDTTAGLPLTLKVIGSLL 448  

                   RGkskeeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIA
                          Wed+L  L +     LD+ + + L++sYD+L  + +++FL IA
  gi|4588066   449 FKQEIGVWEDTLEQLCK--TLNLDE-VYDRLKISYDALKPEAKEIFLDIA 495  

                   CfFNgekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgt
                   CfF g++ +    +  d  n       + L +++ I++ +       d+ 
  gi|4588066   496 CFFIGKNKEEPYYMWTDC-NFYPASNITFLIQRCMIQVGD-------DDE 537  

                   ieMHnLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgt
                    eMH+ L+ +GRe IVr++ +    P+KR      e   d L +++G++ 
  gi|4588066   538 FEMHDQLRDMGRE-IVRREDV---RPWKRSRIWSREGGIDLLRNKKGSS- 582  

                   rsVlGIslDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                    +V  Is   ++++ e+    + F  ++ L++L+   +  + +g    
  gi|4588066   583 -KVKAISIT-WGVKYEFKS--ECFLNLSELRYLHASSS--MLTGD    621  

gi|4588068|gb|AAD25975.1|AF093648_2: domain 1 of 1, from 235 to 621: score 156.3, E = 6.5e-42
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         d+lVGi++H+++    L Lds + V MVG +G  GIGKTT A+A
  gi|4588068   235    ---DELVGIDDHITAVLEKLSLDS-ENVTMVGLYGMGGIGKTTTAKA 277  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++++S     s F   +F++n+r++++          + g+        
  gi|4588068   278 VYNKIS-----SCFDCCCFIDNIRETQD---------QKDGVVV------ 307  

                   LhLQeqfLSkILnqkDikIhdHLGv...........ieERLkdqKVLIiL
                     LQ+++ S+IL+     I+    v+  +++++++ i+ER    K L++L
  gi|4588068   308 --LQKKLVSEILR-----ID-SGSVgfindsggrkmIKERVSRFKILVVL 349  

                   DDVDdleQLdALAketqWFGpGSRIIVTTeDkqLLkaHgInht.IYeVgf
                   DDVD     + + +  + F + SR I+T      L   + n  + YeVg 
  gi|4588068   350 DDVDEKFKFEDMLGNHKDFISQSRFIITSRSVRVLSTLNENQCkLYEVGS 399  

                   PSkeeALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsL
                    Sk + L+ F  +AF++n+Pp  +e L A+ V+  a  LPL L+V GS L
  gi|4588068   400 LSKPHSLELFSKHAFKKNTPPSYYETL-ANDVVYTAAGLPLTLKVIGSLL 448  

                   RGkskeeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIA
                          Wed+L  Lr      LD+ + + L++sYD+L  + +++FL IA
  gi|4588068   449 FKQEIAVWEDTLEQLRR--TLNLDE-VYDRLKISYDALKPEAKEIFLDIA 495  

                   CfFNgekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgt
                   CfF g++ +    +  d  n       + L +K+ I++ +       d+ 
  gi|4588068   496 CFFIGKNKEEPYYMWTDC-NFYPASNITFLIQKCMIQVGD-------DDK 537  

                   ieMHnLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgt
                    +MH+ L+ +GRe IVr++ +    P+KR      ee  d L +++G++ 
  gi|4588068   538 FKMHDQLRDMGRE-IVRREDV---RPWKRSRIWSREEGIDLLLNKKGSS- 582  

                   rsVlGIslDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                    +V  Is   ++++ e+    + F  ++ L++L+   +  + +g    
  gi|4588068   583 -KVKAISIT-RGVKYEFKS--ECFLNLSELRYLHASSS--MLTGD    621  

gi|4588056|gb|AAD25969.1|AF093642_1: domain 1 of 1, from 235 to 621: score 153.4, E = 4.8e-41
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         d+lVGi++H+++      Lds + V MVG +G  GIGKTT A+A
  gi|4588056   235    ---DELVGIDDHITAVLEKMSLDS-ENVTMVGLYGMGGIGKTTTAKA 277  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++++S     s F   +F++n+r++++          + g+        
  gi|4588056   278 VYNKIS-----SCFDRCCFIDNIRETQD---------QKDGVVV------ 307  

                   LhLQeqfLSkILnqkDikIhdHLGv...........ieERLkdqKVLIiL
                     LQ+++ S+IL+     I+    v+ ++++++++ i+ER    K L++L
  gi|4588056   308 --LQKKLVSEILR-----ID-SGSVgfnndsggrkmIKERVSRFKILVVL 349  

                   DDVDdleQLdALAketqWFGpGSRIIVTTeDkqLLkaHgInht.IYeVgf
                   DDVD     + + +  + F + SR I+T      L   + n  + YeVg 
  gi|4588056   350 DDVDEKFKFEDMLGSPKDFISQSRFIITSRSMRVLGTLNENQCkLYEVGS 399  

                   PSkeeALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsL
                    Sk   L+ F  +AF++n+Pp ++e L A+ V+     LPL L+V GS L
  gi|4588056   400 MSKPRSLELFSKHAFKKNTPPSDYEIL-ANDVVDTTAGLPLTLKVIGSLL 448  

                   RGkskeeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIA
                      +   Wed+L  Lr+     LD+ + + L++sYD+L  + +++FL IA
  gi|4588056   449 FKQKIGVWEDTLEQLRK--TLNLDE-VYDRLKISYDALKPEAKEIFLDIA 495  

                   CfFNgekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgt
                   CfF gek +    +  d  n       + L +++ I++ +       ++ 
  gi|4588056   496 CFFIGEKKEEPYYMWTDC-NFYPASNITFLIQRCMIQVGN-------NDE 537  

                   ieMHnLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgt
                    +MH+ L+ +GRe IVr++ +    P+KR     aee  d L +++G++ 
  gi|4588056   538 FKMHDQLRDMGRE-IVRREDV---RPWKRSRIWSAEEGIDLLLNKKGSS- 582  

                   rsVlGIslDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                    +V  Is  +++ + e+    + F  ++ L++L       + +g    
  gi|4588056   583 -KVKAISI-ICGADYEFKS--ECFLNLSELRYLYATFA--MLTGD    621  

gi|4588070|gb|AAD25976.1|AF093649_1: domain 1 of 1, from 235 to 621: score 152.9, E = 7e-41
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         d+lVGi++H+++    L Lds + V MVG +G  GIGKTT A+A
  gi|4588070   235    ---DELVGIDDHITAVLEKLSLDS-ENVTMVGLYGMGGIGKTTTAKA 277  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++++S     s F   +F++n+r++++          + g+        
  gi|4588070   278 VYNKIS-----SCFDRCCFIDNIRETQD---------QKDGVVV------ 307  

                   LhLQeqfLSkILnqkDikIhdHLGv...........ieERLkdqKVLIiL
                     LQ+++  +IL+     I+    v+ ++++++++ i+ER    K L++L
  gi|4588070   308 --LQKKLVYEILR-----ID-SGSVgfnndsggrkmIKERVSRFKILVVL 349  

                   DDVDdleQLdALAketqWFGpGSRIIVTTeDkqLLkaHgInht.IYeVgf
                   DDVD     + + +  + F + SR I+T      L   + n  + YeVg 
  gi|4588070   350 DDVDEKFKFEDMLGSPKDFISQSRFIITSRSMRVLGTLNENQCkLYEVGS 399  

                   PSkeeALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsL
                    Sk   L+ F  +AF++n+Pp ++e L A+ V+     LPL L+V GS L
  gi|4588070   400 MSKPRSLELFSKHAFKKNTPPSDYETL-ANDVVDTTAGLPLTLKVIGSLL 448  

                   RGkskeeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIA
                          Wed+L  L +     LD+ + + L++sYD+L  + +++FL IA
  gi|4588070   449 FKQEIGVWEDTLEQLCK--TLNLDE-VYDRLKISYDALKPEAKEIFLDIA 495  

                   CfFNgekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgt
                   CfF g++ +    +  d  n       + L +++ I++ +       d+ 
  gi|4588070   496 CFFIGKNKEEPYYMWTDC-NFYPASNITFLIQRCMIQVGD-------DDE 537  

                   ieMHnLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgt
                    eMH+ L+ +GRe IVr++ +    P+KR      ee  d L +++G++ 
  gi|4588070   538 FEMHDQLRDMGRE-IVRREDV---RPWKRSRIWSREEGIDLLRNKKGSS- 582  

                   rsVlGIslDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                    +V  Is   ++++ e+    + F  ++ L++L+   +  + +g    
  gi|4588070   583 -KVKAISIT-WGVKYEFKS--ECFLNLSELRYLHASSS--MLTGD    621  

gi|10176997|dbj|BAB10247.1|: domain 1 of 1, from 150 to 541: score 152.2, E = 1.1e-40
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                          + +Gi   l +++ +       + r VGIwG +GIGKTT A+A
  gi|1017699   150    ----GRIGIYSKLLEIENMVNKQP-IGIRCVGIWGMPGIGKTTLAKA 191  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    f+q S     s F  s+F+e                + ++++e +  + 
  gi|1017699   192 VFDQMS-----SAFDASCFIE---------------DYDKSIHEKG--LY 219  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                     L+eq+L      +D  I   L  +++RL+ ++VL++LDDV +     A
  gi|1017699   220 CLLEEQLLPG----NDATIM-KLSSLRDRLNSKRVLVVLDDVRN-----A 259  

                   LAket.....qWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeAL
                   L++e+  ++  W GpGS II+T  Dkq +   gIn  IYeV    ++eA 
  gi|1017699   260 LVGESflegfDWLGPGSLIIITSRDKQVFCLCGINQ-IYEVQGLNEKEAR 308  

                   qIFCrsA.FgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRG.ksk
                   q F +sA+ +++      +eL +++V++ a   PL+ +V G  L+G+k+ 
  gi|1017699   309 QLFLLSAsIKEDMGEQNLQEL-SVRVINYANGNPLAISVYGRELKGkKKL 357  

                   eeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNg
                    e e +   L+     +   kI +  +  YD L+++++ +FL IACfF g
  gi|1017699   358 SEMETAFLKLKR----RPPFKIVDAFKSTYDTLSDNEKNIFLDIACFFQG 403  

                   ekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHn
                   e+v+yV +lL+        +   vL+dK+L+ is        + ++  H+
  gi|1017699   404 ENVNYVIQLLEGC-GFFPHVEIDVLVDKCLVTIS--------ENRVWLHK 444  

                   LLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnT.........
                   L q  GRe I+  + +   + + R+ L ++  I + L++n ++ ++++++
  gi|1017699   445 LTQDIGRE-IINGETV---QIERRRRLWEPWSIKYLLEYNEhkangepkt 490  

                   ......GtgtrsVlGIslDtseieeelnIsekAFegMrNLqFLriykksf
                   + ++ +G++   + G  lDts++   ++ + +AF+ M NL+ L+iy++  
  gi|1017699   491 tfkraqGSE--EIEGLFLDTSNLR--FDLQPSAFKNMLNLRLLKIYCSNP 536  

                   rddgk<-*
                     ++    
  gi|1017699   537 EVHPV    541  

gi|4588060|gb|AAD25971.1|AF093644_1: domain 1 of 1, from 235 to 629: score 151.2, E = 2.2e-40
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         d+lVGi++H+++    L Lds + V MVG +G  GIGKTT A+A
  gi|4588060   235    ---DELVGIDDHITAVLEKLSLDS-ENVTMVGLYGMGGIGKTTTAKA 277  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++++S     s F   +F++n+r++++          + g+        
  gi|4588060   278 VYNKIS-----SCFDRCCFIDNIRETQD---------QKDGVVV------ 307  

                   LhLQeqfLSkILnqkDikIhdHLGv...........ieERLkdqKVLIiL
                     LQ+++ S+IL+     I+    v+ ++++++++ i+ER    K L++L
  gi|4588060   308 --LQKKLVSEILR-----ID-SGSVgfnndsggrkmIKERVSRFKILVVL 349  

                   DDVDdleQLdALAketqWFGpGSRIIVTTeDkqLLkaHgInht.IYeVgf
                   DDVD     + + +  + F + SR I+T      L   + n  + YeVg 
  gi|4588060   350 DDVDEKFKFEDMLGSPKDFISQSRFIITSRSMRVLGTLNENQCkLYEVGS 399  

                   PSkeeALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsL
                    Sk + L+ F  +AF++n+Pp ++e L A+ V+     LPL L+V GS L
  gi|4588060   400 MSKPHSLELFSKHAFKKNTPPSDYETL-ANDVVDTTAGLPLTLKVIGSIL 448  

                   RGkskeeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIA
                          W+d+L  Lr+     LD+ + + L++sYD+L  + +++FL IA
  gi|4588060   449 FKQEIGVWKDTLQQLRK--TLNLDE-VYDRLKISYDALKPEAKEIFLDIA 495  

                   CfFNgekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgt
                   CfF g++ +    +  d  n         L +++ I++ +       d+ 
  gi|4588060   496 CFFIGKNKEVPYYMWTDC-NFYPASNIIFLIQRCMIQVGD-------DDK 537  

                   ieMHnLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgt
                    +MH+ L+ +GRe IVr++ i    P+KR      ee  d L +++G++ 
  gi|4588060   538 FKMHDQLRDMGRE-IVRREDI---RPWKRSRIWSREEGIDLLLNKKGSS- 582  

                   rsVlGIslD.....tseiee.elnIsekAFegMrNLqFLriykksfrddg
                    +V  Is  ++  + +++ + e+    + F  ++ L++   y ++   +g
  gi|4588060   583 -KVKAISMVppwvsWDNNVKyEFKS--ECFLNLSELRYFYAYPTI-LLTG 628  

                   k<-*
                       
  gi|4588060   629 D    629  

gi|7484913|pir||T06145: domain 1 of 1, from 138 to 520: score 150.9, E = 2.7e-40
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                       D  + +G    l+k++ LLc    +  r  GIwG aGIGKTT ARA
  gi|7484913   138    LDRRGRIGVYSRLTKIEYLLCKQPGCIIRSLGIWGMAGIGKTTLARA 184  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++qLS     ++F+ s+F+e                   ++ e +  + 
  gi|7484913   185 AYDQLS-----RDFEASCFIEDFD---------------REFQEKG--FF 212  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                     L++q+        + ++   L  +   L+ ++ L++LDDV +      
  gi|7484913   213 GLLEKQL------GVNPQVT-RLSILLKTLRSKRILLVLDDVRKPLGATS 255  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                      e  W GpGS IIVT +Dkq L +  +n  IY+V    k+e Lq F r
  gi|7484913   256 FLCEFDWLGPGSLIIVTSQDKQVLVQCQVNE-IYKVQGLNKHESLQLFSR 304  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   +AFg++ P     eL + +++  a   PL+L++ G +L+Gk+  + + + 
  gi|7484913   305 CAFGKDVPDQNLLEL-SMKFVDYANGNPLALSICGKNLKGKTPLDMKSVV 353  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                    +L+     +L +kI   L+ sYD+L+  ++++FL I + F+g +vd+V 
  gi|7484913   354 LELKR----HLSDKIFVKLKSSYDALSVSEKEIFLDIVFTFRGANVDNVM 399  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                   + La       r+G + L+dKS + +s        + ++  +nL   +G 
  gi|7484913   400 QSLAGC-GFFPRVGIEALVDKSFVTVS--------ENRVQVNNLIYDVGL 440  

                   eAIVrkQsidhdePg.........KRqFLvDaeeIcdVLtdnTGtgtrsV
                   + I+  Qs   de g   +  + +  q L++ +eI++    + G +   V
  gi|7484913   441 K-IINDQS---DEIGmcyrfvdasNSQSLIEHKEIRE---SEQGYE--DV 481  

                   lGIslDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                     I+lDts++  + +I   AF+ M NL++L iy +++  + +   
  gi|7484913   482 KAINLDTSNLPFKGHI---AFQHMYNLRYLTIYSSINPTKDP    520  

gi|4588052|gb|AAD25967.1|AF093640_1: domain 1 of 1, from 235 to 629: score 149.2, E = 9e-40
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         d+lVGi++H+++    L Lds + V MVG +G  GIGKTT A+A
  gi|4588052   235    ---DELVGIDDHITAVLEKLSLDS-ENVTMVGLYGMGGIGKTTTAKA 277  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++++S     s F   +F++n+r++++          + g+        
  gi|4588052   278 VYNKIS-----SCFDRCCFIDNIRETQD---------QKDGVVV------ 307  

                   LhLQeqfLSkILnqkDikIhdHLGv...........ieERLkdqKVLIiL
                     LQ+++ S+IL+     I+    v+ ++++++++ i+ER    K L++L
  gi|4588052   308 --LQKKLVSEILR-----ID-SGSVgfnndsggrkmIKERVSRFKILVVL 349  

                   DDVDdleQLdALAketqWFGpGSRIIVTTeDkqLLkaHgInht.IYeVgf
                   DDVD     + + +  + F + SR I+T      L   + n  + YeVg 
  gi|4588052   350 DDVDEKFKFEDMLGSPKDFISQSRFIITSRSMRVLGTLNENQCkLYEVGS 399  

                   PSkeeALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsL
                    Sk + L+ F  +AF++n+Pp ++e L A+ V+     LPL L+V GS L
  gi|4588052   400 MSKPHSLELFSKHAFKKNTPPSDYETL-ANDVVDTTAGLPLTLKVIGSIL 448  

                   RGkskeeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIA
                          W+d+L  Lr+     L++ + + L++sYD+L  + +++FL IA
  gi|4588052   449 FKQEIGVWKDTLQQLRK--TLNLNE-VYDRLKISYDALKPEAKEIFLDIA 495  

                   CfFNgekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgt
                   CfF g++ +    +  d  n         L +++ I++ +       d+ 
  gi|4588052   496 CFFIGKNKEVPYYMWTDC-NFYPASNIIFLIQRCMIQVGD-------DDK 537  

                   ieMHnLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgt
                    +MH+ L+ +GRe IVr++ i    P+KR      ee  d L +++G++ 
  gi|4588052   538 FKMHDQLRDMGRE-IVRREDI---RPWKRSRIWSREEGIDLLLNKKGSS- 582  

                   rsVlGIslD.....tseiee.elnIsekAFegMrNLqFLriykksfrddg
                    +V  Is  ++  + +++ + e+    + F  ++ L++   y ++   +g
  gi|4588052   583 -KVKAISMVppwvsWDNNVKyEFKS--ECFLNLSELRYFYAYPTI-LLTG 628  

                   k<-*
                       
  gi|4588052   629 D    629  

gi|4588050|gb|AAD25966.1|AF093639_1: domain 1 of 1, from 235 to 622: score 149.0, E = 1e-39
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         d+lVGi++H+++    L Lds + V MVG +G  GIGKTT A+A
  gi|4588050   235    ---DELVGIDDHITAVLEKLSLDS-ENVTMVGLYGMGGIGKTTTAKA 277  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++++S     s F   +F++n+r++++          + g+        
  gi|4588050   278 VYNKIS-----SCFDRCCFIDNIRETQD---------QKDGVVV------ 307  

                   LhLQeqfLSkILnqkDikIhdHLGv...........ieERLkdqKVLIiL
                     LQ+++ S+IL+     I+    v+  +++++++ i+ER    K L++L
  gi|4588050   308 --LQKKLVSEILR-----ID-SGSVgfindsggrkmIKERVSRFKILVVL 349  

                   DDVDdleQLdALAketqWFGpGSRIIVTTeDkqLLkaHgInht.IYeVgf
                   DDVD     + + +  + F + SR I+T      L   + n  + YeVg 
  gi|4588050   350 DDVDEKFKFEDMLGNHKDFISQSRFIITSRSVRVLSTLNENQCkLYEVGS 399  

                   PSkeeALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsL
                    Sk + L+ F  +AF++n+Pp  +e L A+ V+  a  LPL L+V GS L
  gi|4588050   400 LSKPHSLELFSKHAFKKNTPPSYYETL-ANDVVYTAAGLPLTLKVIGSLL 448  

                   RGkskeeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIA
                          Wed+L  Lr      LD+ + + L++sYD+L  + +++FL IA
  gi|4588050   449 FKQEIAVWEDTLEQLRR--TLNLDE-VYDRLKISYDALKPEAKEIFLDIA 495  

                   CfFNgekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgt
                   CfF g++ +    +  d  n       + L +K+ I++ +       d+ 
  gi|4588050   496 CFFIGKNKEEPYYMWTDC-NFYPASNITFLIQKCMIQVGD-------DDK 537  

                   ieMHnLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgt
                    +MH+ L+ +GRe IVr++ +    P+KR      ee  d L +++G++ 
  gi|4588050   538 FKMHDQLRDMGRE-IVRREDV---RPWKRSRIWSREEGIDLLLNKKGSS- 582  

                   rsVlGIslDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                    +V  Is   ++++ e+    + F  ++ L+F     ++   +g    
  gi|4588050   583 -KVKAISIT-WGVKYEFKS--ECFLNLSELRFFCAESRI-LLTGD    622  

gi|10121908|gb|AAG13418.1|AC000348_15: domain 1 of 1, from 331 to 701: score 144.5, E = 2.4e-38
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      +  + +VG+E  l+ +  L + +s  +V   G +G  GIGKTT A+A
  gi|1012190   331    KVGEFIVGLESPLKDLTGLIDTESSSGVQVLGLYGMGGIGKTTLAKA 377  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++++       +F+ +aF++ +r+  s e         +gl      ++
  gi|1012190   378 FYNKIV-----GNFEQRAFISDIRERSSAE---------NGLVT----LQ 409  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                     L +++   +   +D+ I   L  i+   + +K  ++LDDVD+++Q  A
  gi|1012190   410 KTLIKELFRLVPEIEDVSIG--LEKIKANVHEKKIIVVLDDVDHIDQVHA 457  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   L++et+W+G G  I++TT D ++L    +n + YeV+  ++  AL+ F  
  gi|1012190   458 LVGETRWYGQGTLIVITTRDSEILSKLSVNQQ-YEVKCLTEPQALKLFSY 506  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLR.GkskeeWedm
                   +  ++  P      L +++++ + G LPL+  V GS L + k +++W  +
  gi|1012190   507 HSLRKEEPTKNLLAL-SKKIVQISGLLPLAVEVFGSLLYdKKEEKDWQTQ 555  

                   LpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFN..gekvd
                   L  L++       g+ ++vL  s+ +L+++++  FL IAC+F + + k d
  gi|1012190   556 LDKLKK----TQPGNLQDVLELSFKSLDDEEKKVFLDIACLFLkmEIKKD 601  

                   yVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqq
                    V   L     L+ +  L vL +KSL++i         ++t  MH+  + 
  gi|1012190   602 EVVIVLKGC-GLNAEAALSVLRQKSLVKILA-------NDTLWMHDQIRD 643  

                   LGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslD
                   +GR+  V k+s  +++Pg R  L D  eI  VL++ +Gt+  s+ GI lD
  gi|1012190   644 MGRQ-MVLKES--REDPGLRSRLWDRGEIMTVLNNMKGTS--SIRGIVLD 688  

                   tseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                 F++       ++ ++    + +   
  gi|1012190   689 --------------FKK-------KFARD--PTADE    701  

gi|11357257|pir||T45787: domain 1 of 1, from 154 to 535: score 139.1, E = 9.5e-37
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                          d +Gi   l k++ L       +Vr +GIwG +GIGKTT A+A
  gi|1135725   154    LNMSDNIGIYSKLGKIETLIYKQP-WGVRSIGIWGMPGIGKTTLAKA 199  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    f+qLS      +++ s+F+                   + ++e +  + 
  gi|1135725   200 AFDQLS-----GDYEASCFIKDFN---------------KAFHEKG--LY 227  

                   LhLQeqfLSkILnqk.Dik..IhdHLGvieERLkdqKVLIiLDDVDdleQ
                     L+ +f  kIL+ + +ik++I      +++ L++++VL++LDDV   + 
  gi|1135725   228 GLLEAHF-GKILREElGIKssIT-RPILLRNVLRHKRVLVVLDDV--CKP 273  

                   LdA...LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeA
                   LdA++ L +   WF pGS II+T  Dkq +   +++  IYeV    +eeA
  gi|1135725   274 LDAesfLGG-FDWFCPGSLIIITSRDKQVFSICRVDQ-IYEVPGLNEEEA 321  

                   LqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkske
                   Lq F r+AFg+   ++  ++L +++V+  a   PL+L   G  + +k+ +
  gi|1135725   322 LQLFSRCAFGKEIIHESLQKL-SKKVIDYANGNPLALIFFG-CMSRKNPK 369  

                   eWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNge
                     e + p  ++     L  +I +  +  YD+L+++++ +FL IAC+F+ge
  gi|1135725   370 PIEIAFPKVKK----YLAHEIHDAVKSTYDSLSSNEKNIFLDIACLFRGE 415  

                   kvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnL
                   +vd V  lL+       r+  +vL++K+L+++         +g+++MHnL
  gi|1135725   416 NVDCVIHLLEGC-GFFPRVEINVLVEKCLVSMA--------EGRVVMHNL 456  

                   LqqLGReAIVrk...QsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsV
                    q  GR+ I+  +++ s      +K  +   + e + VL  +        
  gi|1135725   457 IQSIGRK-IINGgkrRS----RLWKPLIIKYFLEDRQVLGSEDIEA---- 497  

                   lGIslDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                     I lD s ++  ++++  AFe M NL++L+i  +  + +     
  gi|1135725   498 --IFLDPSALS--FDVNPMAFENMYNLRYLKICSSNPGNHYA    535  

gi|4588062|gb|AAD25972.1|AF093645_1: domain 1 of 1, from 235 to 629: score 135.7, E = 1e-35
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         d+lVGi++H+++    L Lds + V MVG +G  GIGKTT A+A
  gi|4588062   235    ---DELVGIDDHITAVLEKLSLDS-ENVTMVGLYGMGGIGKTTTAKA 277  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++++S     s F   +F++n+r++++          + g+        
  gi|4588062   278 VYNKIS-----SCFDRCCFIDNIRETQD---------QKDGVVV------ 307  

                   LhLQeqfLSkILnqkDikIhdHLGv...........ieERLkdqKVLIiL
                     LQ+++  +IL+     I+    v+ ++++++++ i+ER    K L++L
  gi|4588062   308 --LQKKLVYEILR-----ID-SGSVgfnndsggrkmIKERVSRFKILVVL 349  

                   DDVDdleQLdALAketqWFGpGSRIIVTTeDkqLLkaHgInht.IYeVgf
                   DDVD     + + +  + F + SR I+T      L   + n  + YeVg 
  gi|4588062   350 DDVDEKFKFEDMLGSPKDFISQSRFIITSRSMRVLGTLNENQCkLYEVGS 399  

                   PSkeeALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsL
                    Sk   L+ F  +AF++n+Pp ++e L A+ V+     LPL L+V GS L
  gi|4588062   400 MSKPRSLELFSKHAFKKNTPPSDYETL-ANDVVDTTAGLPLTLKVIGSIL 448  

                   RGkskeeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIA
                          W+d+L  Lr+     LD+ + + L++sYD+L  + +++FL IA
  gi|4588062   449 FKQEIGVWKDTLQQLRK--TLNLDE-VYDRLKISYDALKPEAKEIFLDIA 495  

                   CfFNgekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgt
                   CfF g++ +    +  d  n         L +++ I++ +       d+ 
  gi|4588062   496 CFFIGKNKEVPYYMWTDC-NFYPASNIIFLIQRCMIQVGD-------DDK 537  

                   ieMHnLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgt
                    +MH+ L+ +GRe IVr++ i    P+KR      ee  d L +++G++ 
  gi|4588062   538 FKMHDQLRDMGRE-IVRREDI---RPWKRSRIWSREEGIDLLLNKKGSS- 582  

                   rsVlGIslD.....tseiee.elnIsekAFegMrNLqFLriykksfrddg
                     V  Is  ++  + +++ + e+    + F  ++ L++   + ++   +g
  gi|4588062   583 -IVKAISMVppwvsWDNNVKyEFKS--ECFLNLSELRYFYADPTI-LLTG 628  

                   k<-*
                       
  gi|4588062   629 D    629  

gi|11358639|pir||T45788: domain 1 of 1, from 204 to 589: score 132.5, E = 9.2e-35
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      r   ++ G++  le++k  L+Ld  +e r+ G+ G +GIGKTT AR 
  gi|1135863   204    REKHEIYGLKQRLEELKEKLDLDC-EETRILGVVGMPGIGKTTLARE 249  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    +  L       +F  +  +  +r          + + ++glD       
  gi|1135863   250 IYETLR-----CKFLRHGLIQDIR----------RTSKEHGLD------- 277  

                   LhLQeqfLSkILnqkDikIhdHLGvieER....LkdqKVLIiLDDVDdle
                    +L   +L ++L+     I+     + E  + +L+ +KVL++LDDV d e
  gi|1135863   278 -CLPALLLEELLGVTIPDIE-STRCAYESykmeLHTHKVLVVLDDVSDKE 325  

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   Q d+L +  +W   GSRI++ T Dk L +    ++t Y V     ++ L 
  gi|1135863   326 QIDVLLGRCNWIRQGSRIVIATSDKSLIQDVA-DYT-YVVPQLNHKDGLG 373  

                   IFCrsAFgQnsPpdG...FeeLeAreVtkLaGnLPLGLrVlGSsLRGksk
                    F r+AF + s  + ++  ++L ++e+++     PL L+ lG  L Gk++
  gi|1135863   374 HFGRYAFDRHSNIHNnevIMKL-SKEFVHYGRGHPLVLKLLGADLNGKDE 422  

                   eeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNg
                   + W+  L  L     ns +  I +vL+vsYD+L++ ++++FL IACf  +
  gi|1135863   423 DHWKTKLATLAE---NSSHS-IRDVLQVSYDELSQVHKDIFLDIACFRSE 468  

                   ekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHn
                    + +y+ +lL  s         k L +K  I++s        ++++eMH+
  gi|1135863   469 DE-SYIASLLDSS---EAASEIKALMNKFMINVS--------EDRVEMHD 506  

                   LLqqLGReAIVrk...QsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrs
                   LL  ++Re  +r+   Q   ++eP     L   ++I dVL +        
  gi|1135863   507 LLYTFARE-LCRRayaQD--GREPHR---LWHHQDITDVLKNIEEGA--E 548  

                   VlGIslDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   V GI l+++e+++e + +   F+ M+ L++L+iy +   + ++   
  gi|1135863   549 VRGIFLNMNEMKREMSLDSCTFKSMCGLRYLKIYSS--HCPQQ    589  

gi|7488376|pir||T04584: domain 1 of 1, from 215 to 589: score 127.8, E = 2.4e-33
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                           l GiE  l+ ++  L+++ k +   +G+ G +GIGKTT    
  gi|7488376   215    -----LFGIETRLKQLEEKLDFECK-DTLTIGVVGMPGIGKTTLTSM 255  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L+ ++      ++F   +F   +r++ +            +  ++s    
  gi|7488376   256 LYEKWQ-----HDFLRCVFLHDVRKMWK-----------DCMMDRS---- 285  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLk....dqKVLIiLDDVDdle
                         f  ++L+ +++  +      +E Lk     +K L++LD V d +
  gi|7488376   286 -----IFIEELLKDDNVNQE-VADFSPESLKalllSKKSLVVLDNVSDKK 329  

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   Q ++L +e+ W   GSRI +TT D+   +   +++t YeV   +  + ++
  gi|7488376   330 QIEVLLGESDWIKRGSRIFITTSDRSVIEG-MVDDT-YEVLRLTGRDSFE 377  

                   IFCrsAF.gQnsPp.dGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkske
                    F   AF+g+  Pp   F++L +r ++  a   PL+L++lG  L Gk+k 
  gi|7488376   378 YFSYFAFsGKLCPPvRTFMNL-SRLFADYAKGNPLALKILGKELNGKDKT 426  

                   eWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFN.g
                    We+ L  L      s +  I++vLrvsYD+L   +++ FL +ACfF++g
  gi|7488376   427 HWEEKLSKLMQ----SPNKTIQDVLRVSYDELGLSHKDVFLDVACFFRsG 472  

                   ekvdyVkalLads...nnLDVrqGLkvLadKSLIhisplgnedkvdgtie
                    +  yV   L +s ++   D     k La K LI+is         g++e
  gi|7488376   473 DE-YYVR-CLVEScdtEAIDTVSEIKDLASKFLINIS--------GGRVE 512  

                   MHnLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrs
                   MH+LL  +G+e        +    g R+ L + +     L +  G    +
  gi|7488376   513 MHDLLYTFGKE-------LG--SQGSRR-LWNHKAVVGALKNRVG----A 548  

                   VlGIslDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   V GI lD+se++++l  + + F +MrNL++L++y +  r+d +   
  gi|7488376   549 VRGIFLDMSELKKKLPLDRSTFIKMRNLRYLKFYSS--RCDRE    589  

gi|10177890|dbj|BAB11222.1|: domain 1 of 1, from 180 to 569: score 121.3, E = 2.3e-31
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                          + VGi a l +++ LL      + r +GIwG +GIGKTT A+A
  gi|1017789   180    ----ERVGIYARLLEIEKLLYKQH-RDIRSIGIWGMPGIGKTTLAKA 221  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    f+  S      ++  s+F+en  +  +ke          gl+       
  gi|1017789   222 VFNHMS-----TDYDASCFIENFDEAFHKE----------GLH------- 249  

                   LhLQeqfLSkIL.nqkDik...IhdHLGvieERLkdqKVLIiLDDVDdle
                    +L ++   kIL++  Di+++ I       ++ L d++ L++LDDV d+ 
  gi|1017789   250 -RLLKERIGKILkDEFDIEssyIM-RPTLHRDKLYDKRILVVLDDVRDSL 297  

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                     +   k   WFG+GS II+T  Dkq +    In  IY V     +eALq
  gi|1017789   298 AAESFLKRLDWFGSGSLIIITSVDKQVFAFCQINQ-IYTVQGLNVHEALQ 346  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    F +s Fg n P     +L + +V+  +   PL+L++ G  L Gk+  e 
  gi|1017789   347 LFSQSVFGINEPEQNDRKL-SMKVIDYVNGNPLALSIYGRELMGKK-SEM 394  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                   e +  +L+     +   kI++vL+  Y +L+++++ + L IA+fF ge+v
  gi|1017789   395 ETAFFELKH----CPPLKIQDVLKNAYSALSDNEKNIVLDIAFFFKGETV 440  

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                   +yV +lL++s     r+   vL+dK+   is        + t+ M+nL q
  gi|1017789   441 NYVMQLLEES-HYFPRLAIDVLVDKCVLTIS--------ENTVQMNNLIQ 481  

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlG...
                       e I     ++  e +      ++  I++ L+++   g    +G+++
  gi|1017789   482 DTCQE-I----FNG--EIETCTRMWEPSRIRYLLEYDELEG----SGetk 520  

                   ..............IslDtseieeelnIsekAFegMrNLqFLriykksfr
                     ++++   ++ ++I lDts+++  +++  +AF+ M NL+FL+iy++   
  gi|1017789   521 ampksglvaehiesIFLDTSNVK--FDVKHDAFKNMFNLKFLKIYNS--- 565  

                   ddgk<-*
                   ++++   
  gi|1017789   566 CSKY    569  

gi|13509217|emb|CAC35328.1|: domain 1 of 1, from 209 to 593: score 119.2, E = 9.3e-31
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         d+lVGi+   e+   L  Ld     r++GI+G  G GKTT A+A
  gi|1350921   209    ---DELVGIDSSVEEVMELMNLDHSTSERIIGIYGMGGLGKTTLAKA 252  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    f+q S      +F+  +F +n+r++           r+ g+        
  gi|1350921   253 VFNQVS-----MQFERCCFLDNIRETL---------LRNDGVVA------ 282  

                   LhLQeqfLSkILnqkDikIhdH....LGvieERLkdqKVLIiLDDVDdle
                     LQ++  S IL+++  +   + +++   i+ER + +K +++LDD+D + 
  gi|1350921   283 --LQNKVISDILRKDSDQAK-NasdgVRIIRERVRRHKIFVVLDDIDESF 329  

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                     d + ++   F   SR  +TT D   L+  +    +   +  S ++ Lq
  gi|1350921   330 HFDEIFGKLGDFSTDSRFLITTRDARTLELLNECK-MFGLEEMSHDHSLQ 378  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    F  +AFg + Pp+++  L ++e++  a  LPL+L+V GS L   +k  W
  gi|1350921   379 LFSKHAFGVDYPPEDYASL-CEEFIQVASGLPLALKVIGSLLFKSDKRFW 427  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                   ed L +L+         k+++ L+vsY++L ++++ +FL IAC+F g k 
  gi|1350921   428 EDKLIELKA----IPSAKVQERLKVSYNELTHNEKQIFLDIACLFVGAKK 473  

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                   +    +  d  +L     L +L+++SL+++++       +++  MH+  +
  gi|1350921   474 EVPMYMWSDC-DLYPASTLRTLVQRSLVRMDD-------NKIFWMHDHIR 515  

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                    LGR  IVr++    ++P KR      ++  d+L +  G+    V   + 
  gi|1350921   516 DLGRT-IVREENS--QNPYKRSRIWSNNDAIDILKNREGND--CVEALRV 560  

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   D+ + +       k F   + L+FL++ +   + +g+   
  gi|1350921   561 DMKGEG--YALTNKEFNQFSRLRFLEVLNG--DLSGN    593  

gi|7484910|pir||T06609: domain 1 of 1, from 811 to 1191: score 119.2, E = 9.5e-31
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                       D  +++G++   e++ sLLc +s  +Vr +GIwG  GIGKTTIA  
  gi|7484910   811    ADKVNMIGMDMQVEEILSLLCIES-LDVRSIGIWGTVGIGKTTIAEE 856  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    f ++S      +++  +    l               ++++  ++    
  gi|7484910   857 IFRKIS-----VQYETCVVLKDLH-------------KEVEVKGHD---- 884  

                   LhLQeqfLSkIL..nqkDikIhd.HLGvieERLkdqKVLIiLDDVDdleQ
                      +e+fLS++L+     i+I+d     ++ RL+ ++ L+iLDDV+d   
  gi|7484910   885 -AVRENFLSEVLevEPHVIRISDiKTSFLRSRLQRKRILVILDDVNDYRD 933  

                   LdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSke.eALq
                    d+  +  + FGpGSRII T  ++  +    I+h +YeV+ P + +  L 
  gi|7484910   934 VDTFLGTLNYFGPGSRIIMTSRNRRVFVLCKIDH-VYEVK-PLDIpKSLL 981  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    + r        p+ ++ L + e +k     P  L  l S        eW
  gi|7484910   982 LLDRGTCQIVLSPEVYKTL-SLELVKFSNGNPQVLQFLSSI-----DREW 1025 

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                    ++  + +t         I  +   s  gL++++  +FL IACfFN  + 
  gi|7484910  1026 NKLSQEVKT----TSPIYIPGIFEKSCCGLDDNERGIFLDIACFFNRIDK 1071 

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                   d+V  +L d       +G+  L+dKSL  is           + M +  q
  gi|7484910  1072 DNVA-MLLDGCGFSAHVGFRGLVDKSLLTISQ-------HNLVDMLSFIQ 1113 

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                     GRe IVr++s d   Pg R  L +a  I+ V+ ++TGt+  ++ GI l
  gi|7484910  1114 ATGRE-IVRQESAD--RPGDRSRLWNADYIRHVFINDTGTS--AIEGIFL 1158 

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   D+ +++  ++ + ++Fe+M+NL+ L+ y++  + ++k   
  gi|7484910  1159 DMLNLK--FDANPNVFEKMCNLRLLKLYCS--KAEEK    1191 

gi|13509215|emb|CAC35327.1|: domain 1 of 1, from 208 to 590: score 118.6, E = 1.4e-30
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         d+lVGi+   e+   LL Lds  e +++GI+G  G GKTT A+A
  gi|1350921   208    ---DELVGIDFSVEEVVKLLNLDSTSE-KIIGIYGMGGLGKTTLAKA 250  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    +++ S      +F+  +F  n+r+             + g+        
  gi|1350921   251 VYNKVS-----MQFERCCFLNNIREAL---------LKNDGVVA------ 280  

                   LhLQeqfLSkIL....nqkDikIhdHLGvieERLkdqKVLIiLDDVDdle
                     LQ++  S IL+++ +q     +     i+ER   +K +++LDDV+ + 
  gi|1350921   281 --LQNKVISDILrkdfGQAKNASD-GVQMIRERVSRHKIFVVLDDVNESF 327  

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                     d + ++ + F   SR  VTT D   L+  +      + +  S ++ L+
  gi|1350921   328 RFDDIFGKLTAFSADSRFLVTTRDARTLERLRGCK-LFKHEGMSHDHSLK 376  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    F  +AFg + Pp+++  L ++e++     LPL+L+V GS L +  k  W
  gi|1350921   377 LFSKHAFGVDYPPEDYASL-CEEFVQVGSGLPLALKVIGSLLFRTEKSFW 425  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                   ed L +L+         ++++ L++sY++L ++++ +FL +ACfF g k 
  gi|1350921   426 EDKLIELKA----IPAVEVQDRLKISYNELTDNEKQIFLDVACFFVGAKK 471  

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                   +    +  d      +    +L+++SL++i+++++         MH+  +
  gi|1350921   472 EIPMYMWSDC-GFYPTTTIRTLVQRSLVRINDNEE-------FWMHDHIR 513  

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                    LGR  IVr++s   ++P KR      ++  d+L +  G+    V   + 
  gi|1350921   514 DLGRA-IVREES---QNPYKRSRIWSNNDAIDILKNREGND--CVEALRV 557  

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   D+++ +  +   ++ F+  + L+FL++ +   + +g+   
  gi|1350921   558 DMRGEG--FALTDEEFKQFSRLRFLEVLNG--DLSGN    590  

gi|13509211|emb|CAC35325.1|: domain 1 of 1, from 209 to 593: score 118.5, E = 1.5e-30
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         d+lVGi+   e+   L  Ld     r++GI+G  G GKTT A+A
  gi|1350921   209    ---DELVGIDSSVEEVMELMNLDHSTSERIIGIYGMGGLGKTTLAKA 252  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    f++ S      +F+  +F +n+r++           r+ g+        
  gi|1350921   253 VFNKVS-----MQFERCCFLDNIRETL---------LRNDGVVA------ 282  

                   LhLQeqfLSkILnqkDikIhdH....LGvieERLkdqKVLIiLDDVDdle
                     LQ++  S IL+++  +   + +++   i+ER + +K +++LDD+D + 
  gi|1350921   283 --LQNKVISDILRKDSDQAK-NasdgVRIIRERVRRHKIFVVLDDIDESF 329  

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                     d + ++   F   SR  +TT D   L+  +    +   +  S ++ Lq
  gi|1350921   330 HFDEIFGKLGDFSTDSRFLITTRDARTLELLNECK-MFGLEEMSHDHSLQ 378  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    F  +AFg + Pp+++  L ++e++  a  LPL+L+V GS L   +k  W
  gi|1350921   379 LFSKHAFGVDYPPEDYASL-CEEFIQVASGLPLALKVIGSLLFKSDKRFW 427  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                   ed L +L+         k+++ L+vsY++L ++++ +FL IAC+F g k 
  gi|1350921   428 EDKLIELKA----IPSAKVQERLKVSYNELTHNEKQIFLDIACLFVGAKK 473  

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                   +    +  d  +L     L +L+++SL+++++       ++   MH+  +
  gi|1350921   474 EVPMYMWSDC-DLYPASTLRTLVQRSLVRMDD-------NKKFWMHDHIR 515  

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                    LGR  IVr++    ++P KR      ++  d+L +  G+    V   + 
  gi|1350921   516 DLGRT-IVREENS--QNPYKRSRIWSNNDAIDILKNREGND--CVEALRV 560  

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   D+ + +       k F+  + L+FL++ +   + +g+   
  gi|1350921   561 DMKGEG--YALTNKEFKQFSRLRFLEVLNG--DLSGN    593  

gi|13509225|emb|CAC35332.1|: domain 1 of 1, from 209 to 593: score 115.9, E = 9.2e-30
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         d+lVGi+   e+   L  Ld     r++GI+G  G GKTT A+A
  gi|1350922   209    ---DELVGIDSSVEEVMELMNLDHSTSERIIGIYGMGGLGKTTLAKA 252  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    f++ S      +F+  +F +n+r++           r+ g+        
  gi|1350922   253 VFNKVS-----MQFERCCFLDNIRETL---------LRNDGVVA------ 282  

                   LhLQeqfLSkILnqkDikIhdH....LGvieERLkdqKVLIiLDDVDdle
                     LQ++  S IL+++  +   + +++   i+ER + +K +++LDD+D + 
  gi|1350922   283 --LQNKVISDILRKDSDQAK-NasdgVRIIRERVRRHKIFVVLDDIDESF 329  

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                     d + ++   F   SR  +TT D   L+  +    +   +  S ++ Lq
  gi|1350922   330 HFDEIFGKLGDFSTDSRFLITTRDARTLELLNECK-MFGLEEMSHDHSLQ 378  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    F  +AFg + Pp+++  L ++e++  a  LPL+L+V GS L   +k  W
  gi|1350922   379 LFSKHAFGVDYPPEDYASL-CEEFIQVASGLPLALKVIGSLLFKSDKRFW 427  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                   ed L +L+         k+++ L+vsY++L ++++ +FL IAC+F g k 
  gi|1350922   428 EDKLIELKA----IPSAKVQERLKVSYNELTHNEKQIFLDIACLFVGAKK 473  

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                   +    +  d  +L     L +L+++SL+++++       ++   MH+  +
  gi|1350922   474 EVPMYMWSDC-DLYPASTLRTLVQRSLVRMDD-------NKMFWMHDHIR 515  

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                    LGR  IVr++    ++P KR      ++  d+L +  G+    V   + 
  gi|1350922   516 DLGRT-IVREENS--QNPYKRSRIWSNNDAIDILKNREGND--CVEALRV 560  

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   D+ + +       k F   + L+FL++ +   + +g+   
  gi|1350922   561 DMKGEG--YALTNKEFNQFSRLRFLEVLNG--DLSGN    593  

gi|11357255|pir||T51141: domain 1 of 1, from 206 to 597: score 115.6, E = 1.1e-29
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                          +  G E  l+ ++  L+ d  ++ r++G+ G +GIGKTT  + 
  gi|1135725   206    ----ETFGNEQRLKDLEEKLDRDKYKGTRIIGVVGMPGIGKTTLLKE 248  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L+  +       +F  +a ++ +r              ++ + e +    
  gi|1135725   249 LYKTWQ-----GKFSRHALIDQIR-------------VKSKHLELD---- 276  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                    +L +++L ++ + ++  ++ +L      L+ +KVL++LDDV + eQ dA
  gi|1135725   277 -RLPQMLLGELSKLNNPHVD-NLKDPYSQLHERKVLVVLDDVSKREQIDA 324  

                   LAketqWF..Gp.GSRIIVTTeDkqLLkaHg.InhtIYeVgfPSkeeALq
                   L     W ++G +GSR+++ T D  L    g +++t Y V      + Lq
  gi|1135725   325 LREILDWIkeGKeGSRVVIATSDMSL--TNGlVDDT-YMVQNLNHRDSLQ 371  

                   IFCrsAFg..QnsPp.dGFeeLeAreVtkLaGnLPLGLrVlGSsLRGksk
                    F+ +AF ++Q  P++ +F++L ++ +++ a   PL+L+VlG  L  ks 
  gi|1135725   372 LFHYHAFIddQANPQkKDFMKL-SEGFVHYARGHPLALKVLGGELNKKSM 420  

                   eeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNg
                   + W   +  L      s   +I +v +vsYD+L    ++ FL IACf  +
  gi|1135725   421 DHWNSKMKKLAQ----SPSPNIVSVFQVSYDELTTAQKDAFLDIACFRSQ 466  

                   ekvdyVkalLadsnnL...DVrqGLkvLadKSLIhisplgnedkvdgtie
                    k dyV++lLa s +L++       k L+dK LI+          dg++e
  gi|1135725   467 DK-DYVESLLASS-DLgsaEAMSAVKSLTDKFLINTC--------DGRVE 506  

                   MHnLLqqLGReAIVrkQsidhdePgKRqFLvDae....eIcdVLtdnTGt
                   MH+LL ++ Re ++ k s+ +d  ++R+     +  ++ I +VL ++   
  gi|1135725   507 MHDLLYKFSRE-VDLKASN-QDGSRQRRLWLHQHiikgGIINVLQNKMKA 554  

                   gtrsVlGIslDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                      +V GI lD+se+e+e + + + F  M NL++L++y++   + ++   
  gi|1135725   555 A--NVRGIFLDLSEVEDETSLDRDHFINMGNLRYLKFYNS--HCPQE    597  

gi|5823587|emb|CAB53785.1|: domain 1 of 1, from 206 to 597: score 115.6, E = 1.1e-29
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                          +  G E  l+ ++  L+ d  ++ r++G+ G +GIGKTT  + 
  gi|5823587   206    ----ETFGNEQRLKDLEEKLDRDKYKGTRIIGVVGMPGIGKTTLLKE 248  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L+  +       +F  +a ++ +r              ++ + e +    
  gi|5823587   249 LYKTWQ-----GKFSRHALIDQIR-------------VKSKHLELD---- 276  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                    +L +++L ++ + ++  ++ +L      L+ +KVL++LDDV + eQ dA
  gi|5823587   277 -RLPQMLLGELSKLNNPHVD-NLKDPYSQLHERKVLVVLDDVSKREQIDA 324  

                   LAketqWF..Gp.GSRIIVTTeDkqLLkaHg.InhtIYeVgfPSkeeALq
                   L     W ++G +GSR+++ T D  L    g +++t Y V      + Lq
  gi|5823587   325 LREILDWIkeGKeGSRVVIATSDMSL--TNGlVDDT-YMVQNLNHRDSLQ 371  

                   IFCrsAFg..QnsPp.dGFeeLeAreVtkLaGnLPLGLrVlGSsLRGksk
                    F+ +AF ++Q  P++ +F++L ++ +++ a   PL+L+VlG  L  ks 
  gi|5823587   372 LFHYHAFIddQANPQkKDFMKL-SEGFVHYARGHPLALKVLGGELNKKSM 420  

                   eeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNg
                   + W   +  L      s   +I +v +vsYD+L    ++ FL IACf  +
  gi|5823587   421 DHWNSKMKKLAQ----SPSPNIVSVFQVSYDELTTAQKDAFLDIACFRSQ 466  

                   ekvdyVkalLadsnnL...DVrqGLkvLadKSLIhisplgnedkvdgtie
                    k dyV++lLa s +L++       k L+dK LI+          dg++e
  gi|5823587   467 DK-DYVESLLASS-DLgsaEAMSAVKSLTDKFLINTC--------DGRVE 506  

                   MHnLLqqLGReAIVrkQsidhdePgKRqFLvDae....eIcdVLtdnTGt
                   MH+LL ++ Re ++ k s+ +d  ++R+     +  ++ I +VL ++   
  gi|5823587   507 MHDLLYKFSRE-VDLKASN-QDGSRQRRLWLHQHiikgGIINVLQNKMKA 554  

                   gtrsVlGIslDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                      +V GI lD+se+e+e + + + F  M NL++L++y++   + ++   
  gi|5823587   555 A--NVRGIFLDLSEVEDETSLDRDHFINMGNLRYLKFYNS--HCPQE    597  

gi|11357254|pir||T51140: domain 1 of 1, from 206 to 597: score 114.0, E = 3.6e-29
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                          +  G E  l+ ++  L+ d  ++ r++G+ G +GIGKTT  + 
  gi|1135725   206    ----ETFGNEQRLKDLEEKLDRDKYKGTRIIGVVGMPGIGKTTLLKE 248  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L+  +       +F  +a ++ +r              ++ + e +    
  gi|1135725   249 LYKTWQ-----GKFSRHALIDQIR-------------VKSKHLELD---- 276  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                    +L +++L ++ + ++  ++ +L      L+ +KVL++LDDV + eQ dA
  gi|1135725   277 -RLPQMLLGELSKLNHPHVD-NLKDPYSQLHERKVLVVLDDVSKREQIDA 324  

                   LAketqWF..Gp.GSRIIVTTeDkqLLkaHg.InhtIYeVgfPSkeeALq
                   L     W ++G +GSR+++ T D  L    g +++t Y V      + Lq
  gi|1135725   325 LREILDWIkeGKeGSRVVIATSDMSL--TNGlVDDT-YMVQNLNHRDSLQ 371  

                   IFCrsAFg..QnsPp.dGFeeLeAreVtkLaGnLPLGLrVlGSsLRGksk
                    F+ +AF ++Q  P++ +F++L ++ +++ a   PL+L+VlG  L  ks 
  gi|1135725   372 LFHYHAFIddQANPQkKDFMKL-SEGFVHYARGHPLALKVLGGELNKKSM 420  

                   eeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNg
                   + W   +  L      s   +I +v +vsYD+L    ++ FL IACf  +
  gi|1135725   421 DHWNSKMKKLAQ----SPSPNIVSVFQVSYDELTTAQKDAFLDIACFRSQ 466  

                   ekvdyVkalLadsnnL...DVrqGLkvLadKSLIhisplgnedkvdgtie
                    k dyV++lLa s +L++       k L+dK LI+          dg++e
  gi|1135725   467 DK-DYVESLLASS-DLgsaEAMSAVKSLTDKFLINTC--------DGRVE 506  

                   MHnLLqqLGReAIVrkQsidhdePgKRqFLvDae....eIcdVLtdnTGt
                   MH+LL ++ Re ++ k s+ +d  ++R+     +  ++ I +VL ++   
  gi|1135725   507 MHDLLYKFSRE-VDLKASN-QDGSRQRRLWLHQHiikgGIINVLQNKMKA 554  

                   gtrsVlGIslDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                      +V GI lD+se+e+e + + + F  M NL++L++y++   + ++   
  gi|1135725   555 A--NVRGIFLDLSEVEDETSLDRDHFINMGNLRYLKFYNS--HCPQE    597  

gi|2660663|gb|AAC79134.1|: domain 1 of 1, from 257 to 638: score 106.7, E = 5.5e-27
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                             GiE  l++m+  L++ds  e + VGI G +GIGKTT A  
  gi|2660663   257    -------GIEPRLKEMEEKLDFDS-LETKTVGIVGMPGIGKTTLAET 295  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L+ ++      ++F+ s F    +               ++ +e++  m 
  gi|2660663   296 LYRKWE-----HKFERSMFFPDAS---------------KMANEHG--M- 322  

                   LhLQeqfLSkILnqkDikI....hdHLGvieERLkdqKVLIiLDDVDdle
                     LQ+++L ++L+  ++ I+ +++      ++ L  +KV++++D V   e
  gi|2660663   323 CWLQKRLLEELLKDTNLNIgyttN-EHEFCKDVLLLKKVFLVIDNVSSEE 371  

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   Q ++L ++ +W  +GS I++T  D   Lk + +++t Y V      + L 
  gi|2660663   372 QIETLFGKWNWIKNGSKIVITSSDESMLKGF-VKDT-YVVPSLNSRDSLL 419  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    F  +AFg + ++    +L ++ + + a   PL+L   G  L Gk+k +W
  gi|2660663   420 WFTNHAFGLDDAQGNLVKL-SKHFLNYAKGNPLALGAFGVELCGKDKADW 468  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                   e+ +  L        +  I++vLr  YD+L e+ +++FL +ACfF  e+ 
  gi|2660663   469 EKRIKTLTL----ISNKMIQDVLRRRYDELTERQKDIFLDVACFFKSENE 514  

                   dyVkalLadsnnLDVrqGLkvLad...KSLIhisplgnedkvdgtieMHn
                   +yV  +  +s +   +  +   +d ++K L++is         g++eMH+
  gi|2660663   515 SYVR-HVVNSCDSESTKSWDEITDlkgKFLVNIS--------GGRVEMHD 555  

                   LLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlG
                    L  +++e     Q    ++ + +  L + ++I   L+++   +  +V G
  gi|2660663   556 ILCTFAKE--LASQAL-TEDTRVHLRLWNYQDIMWFLNNELEME--NVRG 600  

                   IslDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   I lD+s++ ee   + + F  M+NL++L+iy +   ++++   
  gi|2660663   601 IFLDMSKVPEEMTFDGNIFSNMCNLRYLKIYSS--VCHKE    638  

gi|13517483|gb|AAK28812.1|AF310968_1: domain 1 of 1, from 193 to 623: score 105.3, E = 1.5e-26
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         ++lV +   + +++ LL +d  d+  ++G wG  G+GKTT A A
  gi|1351748   193    ---NNLVAMSSRIFEIERLLAMDKLDDTCIIGLWGMGGVGKTTLAEA 236  

                   LfsqLSerhFq.ssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGm
                    +++       +++ + + F+ n+ +              ++   ++   
  gi|1351748   237 CYDRVT----SsNKGIKHLFVRNVNE--------------ICEKHHG-VE 267  

                   KLhLQeqfLSkILnqkDikIhdHLGvi..eERLkdqKVLIiLDDVDdleQ
                   K     ++ Sk+L+ ++i  + +L  + ++ERL + +V+++LD V+ leQ
  gi|1351748   268 KIV--HKLYSKLLDENNIDRE-DLNIAyrRERLSHLRVFVVLDNVETLEQ 314  

                   LdALA.....ketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSke
                   L+ LA +   + ++ F  GSRII+TT +k+ L +      IY V+   +e
  gi|1351748   315 LEQLAlgyvfNLSKVFAAGSRIIITTRNKKVL-QNAMAK-IYNVECLNDE 362  

                   eALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGks
                   e    F ++AF+Q+ P+d  +   +r  t  +   PL+L++lG +L G++
  gi|1351748   363 ESTRLFSLHAFKQDRPQDNWMGK-SRLATSYCKGNPLALKILGGALFGED 411  

                   keeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFN
                    ++W  +L  Lr     s +   e +Lr sYD+L ++++ +FL +AC+ N
  gi|1351748   412 VHYWRSLLTGLRQ----SGNLGMETILRRSYDKLGKEEKKIFLDVACLLN 457  

                   gekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMH
                   g+  +++ ++ a        +  k L dKSL    p +n     + ie H
  gi|1351748   458 GMSKSRLIDYMATM-YSSSYVKVKDLIDKSLLTCVPSEN----GEMIEVH 502  

                   nLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgt....
                    LL +++   IV ++ +     gKR  LvD+ + +  L+      ++++ 
  gi|1351748   503 GLLKEMAWN-IVKEEPK----LGKRSRLVDPDDVHKLLSTSEVKNWstsi 547  

                   .................................rsVlGIslDtseieeel
                    +  ++     +++++++ ++ +++++++ +++r+  GI+lD+s+++ e 
  gi|1351748   548 vnlfkgivmvipkrkkrkvtdmhqkgddpleehRTTEGIRLDLSKTK-EM 596  

                   nIsekAFegMrNLqFLriykksfrddgk<-*
                   +   +AFegM  L FL++    ++  ++   
  gi|1351748   597 YLKANAFEGMNSLTFLKFESP-EIEYPY    623  

gi|9759606|dbj|BAB11394.1|: domain 1 of 1, from 165 to 545: score 104.0, E = 3.6e-26
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                       D  + +Gi   l +++ LLc  s       G wG +GIGKTTIA A
  gi|9759606   165    LDATGKIGIYSRLLEIEKLLCKQS-LKFYYLGLWGMPGIGKTTIAEA 210  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    f q S     ++F  s F+e   + y     + g  rp     Y     
  gi|9759606   211 AFKQMS-----KDFDASFFVEDFHKEY-----HKG--RP-----YK---- 239  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                     L+e+ L k+ +   i+ +  L   +E L+ +KVL +LDDV +l+  + 
  gi|9759606   240 --LREEHLKKVPKGGSIRGP-IL-SFKE-LREKKVLFVLDDVRNLMDFES 284  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                     + ++   pGS II T  Dkq L +  +++ + eV    +eeA   F r
  gi|9759606   285 FLGGIEGVSPGSVIILTSRDKQVLHQCQVED-VFEVPSLNEEEAVRLFAR 333  

                   sAFgQnsPpdG.FeeLeAreVtkLaGnLPLGLrVlGSsLRGksk.eeWed
                    AF +  P d + ++  +++V++ aG  P +L+  G  L  k+k+ee e+
  gi|9759606   334 TAFHKEGPSDAkLMDV-SKKVARYAGGNPKALCFYGRELEKKKKpEEMEE 382  

                   mLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdy
                   +    r     +  ++I +  r sYD+L++++ ++FL IACfFNge +d+
  gi|9759606   383 EFEKMRQ----CPPQEILSLFRSSYDALNDNERSIFLDIACFFNGEPCDD 428  

                   VkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqL
                   V   L+        +G   La++SL  is        ++++eM    q  
  gi|9759606   429 VMRILEGC-GFFPHVGIDRLAERSLLTISK-------EKRVEMQGFIQDA 470  

                   GReAIVrk......QsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVl
                   +Re  + +++++++++    eP   + L +           +G++   + 
  gi|9759606   471 ARE-FINQtsrrrrHW----EPSRIRLLLEND-------KSKGNE--VIE 506  

                   GIslDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   GI lDt+++   ++++  AFe M NL+ L+iy + +  +++   
  gi|9759606   507 GIFLDTTKLT--FDVNPMAFENMYNLRLLKIYSTHSETAQE    545  

gi|11761682|gb|AAG40141.1|AF209498_1: domain 1 of 1, from 1 to 173: score 103.7, E = 4.5e-26
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                +V           GKTTIARA
  gi|1176168     1    -------------------------GGV-----------GKTTIARA 11   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L+ +LS       Fq+saFm+n++++y          r ++lD+Y+  +K
  gi|1176168    12 LYTRLS-----PIFQHSAFMGNIKETY----------RRISLDDYG--SK 44   

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   LhLQe+fLSk++n+kD+kI+ H Gv++ERLkd++V+++LDDVD leQL A
  gi|1176168    45 LHLQEEFLSKLINHKDVKIP-HSGVVRERLKDKRVFVVLDDVDELEQLIA 93   

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   LAke +WFG+GSRI+VTT+D+qLLkaHgI++ +Y+V++PS+ eAL+IFC+
  gi|1176168    94 LAKEPRWFGSGSRIVVTTQDRQLLKAHGIDL-VYKVELPSRLEALEIFCQ 142  

                   sAFgQnsPp.dGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedm
                   sAFgQ+ Pp  G  eL A +Vt+LaG+LPLGL                  
  gi|1176168   143 SAFGQKHPPcVGIREL-ALQVTHLAGYLPLGL------------------ 173  

                   LpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyV
                                                                     
  gi|1176168     - -------------------------------------------------- -    

                   kalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLG
                                                                     
  gi|1176168     - -------------------------------------------------- -    

                   ReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDts
                                                                     
  gi|1176168     - -------------------------------------------------- -    

                   eieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                        
  gi|1176168     - ----------------------------------    -    

gi|13509209|emb|CAC35323.1|: domain 1 of 1, from 209 to 591: score 103.5, E = 5e-26
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         d+lVGi+    +m  LL Lds  e +++GI+G    GKTT A A
  gi|1350920   209    ---DELVGIDFSVDEMVKLLNLDSTSE-KIIGIYGMGRLGKTTLATA 251  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    +++ S      +F+  +F +n+r           et  ++         
  gi|1350920   252 VYNKVS-----MQFERCCFLDNIR-----------ETLLKNDGV------ 279  

                   LhLQeqfLSkILnqkDikIhdHLG....vieERLkdqKVLIiLDDVDdle
                     LQ++  S IL+++  +   +  ++ + i+ER   +K +++LDDV+ + 
  gi|1350920   280 VALQNKVISDILRKDFCQAK-NASdgvqMIRERVSRHKIFVVLDDVNESF 328  

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                     d + ++ + F   SR  VTT D   L+  +      + +  S ++ L+
  gi|1350920   329 RFDDIFGKLTAFSADSRFLVTTRDARTLERLRGCK-LFKHEGMSHDHSLK 377  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    F  +AFg + Pp+++  L ++e++     LPL+L+V GS L +  k  W
  gi|1350920   378 LFSKHAFGVDYPPEDYASL-CEEFVQVGSGLPLALKVIGSLLFRTEKSFW 426  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                   +d L +L+         +++  L++sY++L ++++ +FL +AC+F g k 
  gi|1350920   427 KDKLIELKA----IPAVNVQYRLKISYNELTDNEKQIFLDVACLFVGAKK 472  

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                   +    +  d      +    +L+++SL++i+++++         MH+  +
  gi|1350920   473 EIPIYMWSDC-GFYPTTTIRTLVQRSLVRINDNEE-------FWMHDHIR 514  

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                    LGR  IV+++s   ++  KR      ++  d+L +  G+    V   + 
  gi|1350920   515 DLGRA-IVCEES---QNLYKRSRIWSNNDAIDILKNREGND--CVEALRV 558  

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   D+++ +  +    + F+  + L+FL++ +   + +g+   
  gi|1350920   559 DMRGEG--FALTNEEFKQFSRLRFLEVLNG--DLSGN    591  

gi|13509223|emb|CAC35331.1|: domain 1 of 1, from 209 to 591: score 103.5, E = 5e-26
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         d+lVGi+    +m  LL Lds  e +++GI+G    GKTT A A
  gi|1350922   209    ---DELVGIDFSVDEMVKLLNLDSTSE-KIIGIYGMGRLGKTTLATA 251  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    +++ S      +F+  +F +n+r           et  ++         
  gi|1350922   252 VYNKVS-----MQFERCCFLDNIR-----------ETLLKNDGV------ 279  

                   LhLQeqfLSkILnqkDikIhdHLG....vieERLkdqKVLIiLDDVDdle
                     LQ++  S IL+++  +   +  ++ + i+ER   +K +++LDDV+ + 
  gi|1350922   280 VALQNKVISDILRKDFCQAK-NASdgvqMIRERVSRHKIFVVLDDVNESF 328  

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                     d + ++ + F   SR  VTT D   L+  +      + +  S ++ L+
  gi|1350922   329 RFDDIFGKLTAFSADSRFLVTTRDARTLERLRGCK-LFKHEGMSHDHSLK 377  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    F  +AFg + Pp+++  L ++e++     LPL+L+V GS L +  k  W
  gi|1350922   378 LFSKHAFGVDYPPEDYASL-CEEFVQVGSGLPLALKVIGSLLFRTEKSFW 426  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                   +d L +L+         +++  L++sY++L ++++ +FL +AC+F g k 
  gi|1350922   427 KDKLIELKA----IPAVNVQYRLKISYNELTDNEKQIFLDVACLFVGAKK 472  

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                   +    +  d      +    +L+++SL++i+++++         MH+  +
  gi|1350922   473 EIPIYMWSDC-GFYPTTTIRTLVQRSLVRINDNEE-------FWMHDHIR 514  

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                    LGR  IV+++s   ++  KR      ++  d+L +  G+    V   + 
  gi|1350922   515 DLGRA-IVCEES---QNLYKRSRIWSNNDAIDILKNREGND--CVEALRV 558  

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   D+++ +  +    + F+  + L+FL++ +   + +g+   
  gi|1350922   559 DMRGEG--FALTNEEFKQFSRLRFLEVLNG--DLSGN    591  

gi|13517477|gb|AAK28810.1|AF310964_1: domain 1 of 1, from 193 to 624: score 102.5, E = 9.9e-26
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         ++lV +   + +++ LL +d  d+  ++G wG  G+GKTT A A
  gi|1351747   193    ---NNLVAMSSRIFEIERLLAMDKLDDTFIIGLWGMGGVGKTTLAEA 236  

                   LfsqLSerhFq.ssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGm
                    + +       +++ + + F+ n+ +              ++   ++   
  gi|1351747   237 CYERVT----SsNKGIKHLFVRNVNE--------------ICEKHHG-VE 267  

                   KLhLQeqfLSkILnqkDikIhdHLGvi..eERLkdqKVLIiLDDVDdleQ
                   K     ++ Sk+L+ ++i  + +L  + +++RL + +V+++LD V+ leQ
  gi|1351747   268 KIV--HKLYSKLLDENNIDRE-DLNIAyrRQRLSHLRVFVVLDNVETLEQ 314  

                   LdALA.....ketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSke
                   L+ LA +   + ++ F  GSRII+TT +k+ L +      IY V+   ++
  gi|1351747   315 LEQLAlgyvfNLSKVFAAGSRIIITTRNKKVL-QNAMAK-IYNVECLNDK 362  

                   eALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGks
                   e    F ++AF+Q+ P+d   +  +   t  +   PL+L++lG +L G++
  gi|1351747   363 ESIRLFSLHAFKQDRPQDNWTDK-SHLATSYCKGNPLALKILGGALFGED 411  

                   keeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFN
                    ++W  +L  Lr     s +   e +Lr sYD+L ++++ +FL +AC+ N
  gi|1351747   412 VHYWRSLLTGLRQ----SGNLGMETILRRSYDKLGKEEKKIFLDVACLLN 457  

                   gekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMH
                   g+  +++ ++ a        +  k L dKSL    p +n     + ie H
  gi|1351747   458 GMSKSRLIDYMATM-YSSSYVKVKDLIDKSLLTCVPSEN----GEMIEVH 502  

                   nLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgt....
                   +LL +++   IV ++ +     gKR  LvD+ + +  L+      ++++ 
  gi|1351747   503 DLLKEMAWN-IVKEEPK----LGKRSRLVDPDDVHKLLSTSEVKNWstsi 547  

                   .................................rsVlGIslDtseieeel
                    +  ++     +++++++ ++ +++++++ +++r+  GI+lD+s+++ e 
  gi|1351747   548 vnlfkgivmvipkrkkrkvtdmhqkgddpleehRTTEGIRLDLSKTK-EM 596  

                   nIsekAFegMrNLqFLriykksfrddgk<-*
                   +   +AFegM  L FL++     ++  +   
  gi|1351747   597 YLKANAFEGMNSLTFLKFESPEMKYPHH    624  

gi|13517480|gb|AAK28811.1|AF310966_1: domain 1 of 1, from 193 to 624: score 102.5, E = 1e-25
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         ++lV ++  + +++ LL +d  d+  ++G wG  G+GKTT A A
  gi|1351748   193    ---NNLVAMGSRIFEIERLLAMDKLDDTCIIGLWGMGGVGKTTLAEA 236  

                   LfsqLSerhFq.ssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGm
                    + +       +++ + + F+ n+ +              ++   ++   
  gi|1351748   237 CYERVT----SsNKGIKHLFVRNVNE--------------ICEKHHG-VE 267  

                   KLhLQeqfLSkILnqkDikIhdHLGvi..eERLkdqKVLIiLDDVDdleQ
                   K     ++ Sk+L+ ++i  + +L  + ++ERL   +V+++LD V+ leQ
  gi|1351748   268 KIV--HKLYSKLLDENNIDRE-DLNIAyrRERLSRSRVFVVLDNVETLEQ 314  

                   LdALA.....ketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSke
                   L+ LA +   + ++ F  GSRII+TT +k+ L +      IY V+   ++
  gi|1351748   315 LEQLAlgyvfNLSKVFAAGSRIIITTRNKKVL-QNAMAK-IYNVECLNNK 362  

                   eALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGks
                   e    F ++AF+Q+ P+d   +  +   +  +   PL+L++lG +L G++
  gi|1351748   363 ESIRLFSLHAFKQDRPQDNWTDK-SHLAISYCKGNPLALKILGGALFGED 411  

                   keeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFN
                    ++W  +L  Lr     s +  Ie++Lr sYD+L ++++ +F  +AC+  
  gi|1351748   412 VHYWRSLLTGLRQ----SGNLGIESILRRSYDKLGKEEKKIFMDVACLLY 457  

                   gekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMH
                   g+ ++++ ++ a        ++ k L dKSL    p +n     + ie H
  gi|1351748   458 GMSRSRLIDYMATM-YSSSYVRVKDLIDKSLLTCVPSEN----GEMIEVH 502  

                   nLLqqLGReAIVrk....................................
                   +LL +++   IV ++++ +++++  ++++ ++  ++++ ++ +++  +  
  gi|1351748   503 DLLKEMAWN-IVKEepklgkrsrlvdpddvhkllstsevknwstsivnlf 551  

                   ....QsidhdePgKRqFLvDaeeI.cdVLtdnTGtgtrsVlGIslDtsei
                   ++    i     +KR+  +D +e ++d L+++  t+     GI lD+s++
  gi|1351748   552 kgivMVI---PRRKRRKVTDMHERgYDPLEEHRTTE-----GICLDLSGT 593  

                   eeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   + e +   +AFegM  L FL+++    +++++   
  gi|1351748   594 K-EMYLKANAFEGMNSLTFLKFKSPELDYAQY    624  

gi|15028063|gb|AAK76562.1|: domain 1 of 1, from 2 to 337: score 100.4, E = 4.5e-25
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                          + +Gi   l +++ +       + r VGIwG +GIGKTT A+A
  gi|1502806     2    ----ERIGIYSKLLEIEKMINKQP-LDIRCVGIWGMPGIGKTTLAKA 43   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    f+q S       F  ++F+e                +++ + e +  + 
  gi|1502806    44 VFDQMS-----GEFDAHCFIE---------------DYTKAIQEKG--VY 71   

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                     L+eqfL +  +  +      L  +++RL++++VL++LDDV    + + 
  gi|1502806    72 CLLEEQFLKENAGASGTVTK--LSLLRDRLNNKRVLVVLDDVRSPLVVES 119  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                     +   WFGp S II+T +Dk  ++  ++n  IYeV    ++eALq F +
  gi|1502806   120 FLGGFDWFGPKSLIIITSKDKSVFRLCRVNQ-IYEVQGLNEKEALQLFSL 168  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGksk.eeWedm
                   +A   + +     e  + +V+k a   PL+L+  G  L Gk+ + e e +
  gi|1502806   169 CASIDDMAEQNLHEV-SMKVIKYANGHPLALNLYGRELMGKKRpPEMEIA 217  

                   LpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyV
                      L+     +      +  + sYD L+++++ +FL IACfF ge+vdyV
  gi|1502806   218 FLKLKE----CPPAIFVDAIKSSYDTLNDREKNIFLDIACFFQGENVDYV 263  

                   kalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLG
                    +lL+        +G  vL++KSL+ is        + +++MHnL q +G
  gi|1502806   264 MQLLEGC-GFFPHVGIDVLVEKSLVTIS--------ENRVRMHNLIQDVG 304  

                   ReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDts
                   R+ I+ ++         Rq               T  +           s
  gi|1502806   305 RQ-IINRET--------RQ---------------TKRR-----------S 319  

                   eieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   ++ e  +I           ++L  +k     +++   
  gi|1502806   320 RLWEPCSI-----------KYLLEDK-----EQN    337  

gi|13517469|gb|AAK28806.1|AF310960_2: domain 1 of 1, from 193 to 624: score 97.1, E = 4.4e-24
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         ++lV ++  + +++ LL +d  d+  ++G wG  G+GKTT A A
  gi|1351746   193    ---NNLVAMGSRIFEIERLLAMDKLDDTCIIGLWGMGGVGKTTLAEA 236  

                   LfsqLSerhFq.ssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGm
                    + +       +++ + + F+ n+ +              ++   ++   
  gi|1351746   237 CYERVT----SsNKGIKHLFVRNVNE--------------ICEKHHG-VE 267  

                   KLhLQeqfLSkILnqkDikIhdHL..GvieERLkdqKVLIiLDDVDdleQ
                   K     ++ Sk+L+ ++i  + +L+ G  +ERL   +V+++LD V+ leQ
  gi|1351746   268 KIV--HKLYSKLLDENNIDRE-DLniGYRRERLSRSRVFVVLDNVETLEQ 314  

                   LdALA.....ketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSke
                   L+ LA +   + ++ F  GSRII+TT +k+ L +      IY V+   ++
  gi|1351746   315 LEQLAlgyvfNLSKVFAAGSRIIITTRNKKVL-QNAMAK-IYNVECLNNK 362  

                   eALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGks
                   e    F ++AF+Q+ P+d   +  +   +  +   PL+L++lG +L G++
  gi|1351746   363 ESIRLFSLHAFKQDRPQDNWTDK-SHLAISYCKGNPLALKILGGALFGED 411  

                   keeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFN
                    ++W  +L  Lr     s +  Ie++Lr sYD+L ++++ +F  +AC+  
  gi|1351746   412 VHYWRSLLTGLRQ----SGNLGIESILRRSYDKLGKEEKKIFMDVACLLY 457  

                   gekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMH
                   g+ ++++ ++ a        ++ k L dKSL    p +n     + ie H
  gi|1351746   458 GMSRSRLIDYMATM-YSSSYVRVKDLIDKSLLTCVPSEN----GEMIEVH 502  

                   nLLqqLGReAIVrk....................................
                   +LL +++   IV ++++ +++++  ++++ ++  ++++ ++ +++  +  
  gi|1351746   503 DLLKEMAWN-IVKEepklgkrsrlvdpddvhkllstsevknwstsivnlf 551  

                   ....QsidhdePgKRqFLvDaeeI.cdVLtdnTGtgtrsVlGIslDtsei
                   ++    i     +KR+  +D +e ++d L+++  t+     GI lD+s++
  gi|1351746   552 kgivMVI---PRRKRRKVTDMHERgYDPLEEHRTTE-----GICLDLSGT 593  

                   eeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   + e +   +AFegM  L FL+++    ++ ++   
  gi|1351746   594 K-EMYLKANAFEGMNSLTFLKFKSPELDYPQY    624  

gi|10177889|dbj|BAB11221.1|: domain 1 of 1, from 202 to 600: score 93.3, E = 6e-23
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      +  + + GiE  ++ ++  L++ s++  r +G+ G +GIGKTT A  
  gi|1017788   202    KRHETFWGIELRIKQLEEKLRFGSDETTRTIGVVGMPGIGKTTLATM 248  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L+ ++      ++F  ++ +  +            e ++    +Y     
  gi|1017788   249 LYEKWN-----DRFLRHVLIRDIH-----------EASEEDGLNY----- 277  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdq....KVLIiLDDVDdle
                     L  +fL  +L+ ++  I+    ++ E  kdq  ++KVL+iLD V + +
  gi|1017788   278 --LATKFLQGLLKVENANIE-SVQAAHEAYKDQlletKVLVILDNVSNKD 324  

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   Q dAL +e +W   GS I +TT Dk L+ +  +n+t YeV   S+++A +
  gi|1017788   325 QVDALLGERNWIKKGSKILITTSDKSLMIQSLVNDT-YEVPPLSDKDAIK 373  

                   IFCrsAFgQn...sPpdG...FeeLeAreVtkLaGnLPLGLrVlGSsLRG
                    F r+AF  n++  P  G+++F +L ++ +++     PL+L  lG  L G
  gi|1017788   374 HFIRYAFDGNegaAPGPGqgnFPKL-SKDFVHYTKGNPLALQMLGKELLG 422  

                   kskeeWedmLpRLrtsfgnsLD....gkIekvL.rv...sYDgLhekDqa
                   k++  W   L  L      + ++++++ I k L+rv ++sY +L++k+++
  gi|1017788   423 KDESHWGLKLNALDQ----HHNsppgQSICKMLqRVwegSYKALSQKEKD 468  

                   LFLhIACfFNgekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgne
                     L IACf  + + +yV +lL  +     ++ L+ L++K  I+i      
  gi|1017788   469 ALLDIACFRSQDE-NYVASLLDSD---GPSNILEDLVNKFMINIY----- 509  

                   dkvdgtieMHnLL....qqLGReAIVrkQsidhdePgKRqFLvDaeeIcd
                       g + MH+ L   + +LGReA     +        R+ L   + I  
  gi|1017788   510 ---AGKVDMHDTLymlsKELGREATATDRK-------GRHRLWHHHTIIA 549  

                   VLtdnTGtgtrsVlGIslDtseieeelnIsekAFegMrNLqFLriykksf
                   VL+ n+G +  ++  I lD+s i ++ +    AF  Mr+L++L+iy +  
  gi|1017788   550 VLDKNKGGS--NIRSIFLDLSDITRKWCFYRHAFAMMRDLRYLKIYST-- 595  

                   rddgk<-*
                    + ++   
  gi|1017788   596 HCPQE    600  

gi|9758979|dbj|BAB09489.1|: domain 1 of 1, from 205 to 596: score 92.4, E = 1.1e-22
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         d   Gi+  l++++  L+L   ++ r +G+ G +GIGKTT  + 
  gi|9758979   205    ---DKTFGIKQRLKELEEKLDLVKYKGTRVIGVVGMPGIGKTTLVKE 248  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L+  +       +F   a ++ +rg          ++ +  l      + 
  gi|9758979   249 LYKTWQ-----GKFSRYALIDQIRG----------KSNNFRLEC----LP 279  

                   LhLQeqfLSkILnqkDikIhdHLGvieE.......RLkdqKVLIiLDDVD
                     L e++L ++ n      + +L  ieE+ +++++ L+ +KVL++LDDV 
  gi|9758979   280 TLLLEKLLPELNN------P-QLDSIEEpykthkgLLRERKVLVVLDDVS 322  

                   dleQLdALAket......qWFGpGSRIIVTTeDkqLLkaHgInhtIYeVg
                     eQ  AL ++ + +++++W   GSRII+ T+D   Lk   + +t Y V 
  gi|9758979   323 RREQIYALLGKYdlhskhEWIKDGSRIIIATNDISSLKGL-VHDT-YVVR 370  

                   fPSkeeALqIFCrsAF..gQnsPp.dGFeeLeAreVtkLaGnLPLGLrVl
                        + Lq F  +AF+  Q +Pp+ +F++L + e+++ a   PL+L++l
  gi|9758979   371 QLNHRDGLQLFRYHAFhyDQATPPkVDFMKL-SDEFVHYARGHPLALKIL 419  

                   GSsLRGkskeeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLF
                   G  L  k+ + We  L  L      s    I +v +vsYD+L+   ++ F
  gi|9758979   420 GRELYEKNMKHWETKLIILAQ----SPTTYIGEVVQVSYDELSLAQKDAF 465  

                   LhIACfFNgekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedk
                   L IAC F+ ++vdyV++lL  s +       k L +K LI          
  gi|9758979   466 LDIAC-FRSQDVDYVESLLVSS-DPGSAEAIKALKNKFLIDTC------- 506  

                   vdgtieMHnLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnT
                    dg++eMH+LL  + Re  + k s+ +    +R+  v  ++I +V     
  gi|9758979   507 -DGRVEMHDLLYRFSRE-LDLKAST-QGGSKQRRLWV-RQDIINVQQKTM 552  

                   GtgtrsVlGIslDtseieeelnIsekAFegMrNLqFLriykksfrddgk<
                   G    +V GI lD+se++ e + + + F+ MrNL++L+ y++   + ++ 
  gi|9758979   553 GAA--NVRGIFLDLSEVKVETSLDREHFKNMRNLRYLKLYNS---HCPH  596  

                   -*
                     
  gi|9758979     -    -    

gi|7488375|pir||T04583: domain 1 of 2, from 263 to 557: score 91.7, E = 1.9e-22
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                          +lVG+EaH+ekmk LL Lds + Vr +GI+G +G GKTTIA+ 
  gi|7488375   263    SASQGLVGMEAHMEKMKELLGLDS-NKVRLIGICGLPGSGKTTIAKR 308  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L+ qL       +F+ls ++  ++g+y         +r+ + +e +   K
  gi|7488375   309 LYQQLL-----PQFELSTIIIDIKGCY---------PRT-CYNEDD--RK 341  

                   LhLQeqfLSkILnqkDi.kIhdHLGvieERLkdqKVLIiLDDVDdleQLd
                   L+LQ ++LS++Ln+k  ++I  +L ++ E+Lkd+KV ++LDDVD + QLd
  gi|7488375   342 LQLQSHLLSQLLNHKFTgEIL-QLEAAHEMLKDKKVVLVLDDVDSIGQLD 390  

                   ALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFC
                   ALA+e++WFGpGSRII+TT+D+ LL+  gI + IY V+fP          
  gi|7488375   391 ALANEARWFGPGSRIIITTQDQRLLEEQGIQY-IYNVDFP---------- 429  

                   rsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedm
                           Pp+G   L           LP                     
  gi|7488375   430 --------PPNG---L-----------LP--------------------- 436  

                   LpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLh..IACfFNgekvd
                        t      +   e++L+ s+ +  + D   F+ ++I  f N+++  
  gi|7488375   437 -----T-----VYIYCEDTLQYSFASHLSMD---FRRkgISAFVNYSETL 473  

                   yVkalLadsnnLDVrqGLkvLa.dKSLIhisplgnedkvdgtieMHnLLq
                   +V +   +s          vL+  KS ++ s          +  M     
  gi|7488375   474 DVIERVSAS----------VLVfSKSCVS-S--------TSCLDM----- 499  

                   qLGReAIVrk.QsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIs
                          Vr  Q+                        +TG +   V    
  gi|7488375   500 ------LVRVfQC----------------------RRKTG-Q--LVVPVY 518  

                   lDtseieeelnIsekAFegMrN....LqFLriykksfrddgk<-*
                     +s  + +++ + k+ +++r  ++ Lq Lr       +  +   
  gi|7488375   519 YGISSSD-VVVQEHKSVDRIREwssaLQELRELPG--HHNRE    557  

gi|13509213|emb|CAC35326.1|: domain 1 of 1, from 209 to 600: score 90.0, E = 6.1e-22
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         d+lVGi+    +   LL Lds    +++GI G  G GKTT A+A
  gi|1350921   209    ---DELVGIDSRVDEVVGLLNLDSSTSEKIIGIHGMGGLGKTTLAKA 252  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    +++ S      +F+   F en+r                 l e +    
  gi|1350921   253 VYDKVS-----TKFERCYFLENIR---------------DTLSEKN--GV 280  

                   LhLQeqfLSkILnqk.........DikIhdHLGvieERLkdqKVLIiLDD
                     LQ++  S IL+++ ++ ++ +++i+I       ++R + +K LI+LDD
  gi|1350921   281 SILQNKIISGILRKDfneaknasdGIRII------RDRVCRHKLLIVLDD 324  

                   VDdleQLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSk
                   VD   Q d   ++ + F   SR  +TT D   L+  +    + e    S 
  gi|1350921   325 VDEKFQFDEVLGKLNNFSMDSRFLITTRDARGLELLRECK-MFELQEMSP 373  

                   eeALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGk
                   ++ L+ F   AFg  +Pp+++  L ++e++  a  LPL  +V GS L ++
  gi|1350921   374 DHSLTLFNKNAFGAEFPPEDYAIL-SNEFVQAAAGLPLYIKVIGSLLFRM 422  

                   skeeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfF
                   +k  We+ L ++++        k+++ L++sY++L  +++ +FL IAC F
  gi|1350921   423 DKIFWEEKLEEFKK----ISPTKVQERLKISYNELTYNEKQIFLDIACYF 468  

                   NgekvdyVkalLadsnnLDV..rqGLkvLadKSLIhisplgnedkvdgti
                    g+   +++ +   s + D  ++     L+++SLI+  + + + +   t 
  gi|1350921   469 IGSY--KIEPMRMWS-DCDFypESTIRYLTQRSLIKLQRSEVKGDDINTF 515  

                   eMHnLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtr
                    MHn  + LGR  IVr++ +  ++P KR      ++  d L +++Gt + 
  gi|1350921   516 QMHNHVRDLGRA-IVREENN--QNPYKRSRIWSNKDAIDMLKHKKGTDCV 562  

                   sVlGIslDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                    Vl    D+ + +  l+   k +e+++ L++L++ +   r +g    
  gi|1350921   563 EVL--TVDMEGED--LILTNKELEKLTRLRYLSVSNA--RLAGD    600  

gi|6598361|gb|AAF18599.1|AC002354_8: domain 1 of 1, from 26 to 402: score 89.3, E = 9.3e-22
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                            +Gi   + k++ +       + r +GIwG +GIGKTT A A
  gi|6598361    26    ------IGIYRKMLKLEKIVYKQL-WGIRSIGIWGMPGIGKTTLAEA 65   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    f+q+S      +++ s+++               +   a    Y     
  gi|6598361    66 AFDQFS-----GDYEASCIIKDFD-----------KEFLAKGL-Y----- 93   

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                    hL ++ L + +n   ik             +++ LI+LD V  l+ LdA
  gi|6598361    94 -HLWNEYLGENINNSFIKSG-----------QKRLLIVLDNV--LKPLDA 129  

                   ...LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqI
                   +  L +   WFGpGS II+T  Dkq L + g+n  IYeV+   k+eA q 
  gi|6598361   130 dafLNG-FDWFGPGSLIIITSRDKQVLVQCGVNQ-IYEVEGLNKDEAKQL 177  

                   FCrsAFgQnsPp.dGFeeLeA...reVtkLaGnLPLGLrVlGSsLRGksk
                   ++ +AFg +  ++ G e L A+    V    Gn PL+L+     L  ++ 
  gi|6598361   178 LHGCAFGIDWRKqSGLETL-ApyyISVKYFSGN-PLALSLYEEMLSHMKS 225  

                   eeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNg
                   +  e  L  L      +    I++v +  Y++L+e+++++FL IACfF+g
  gi|6598361   226 DKMEVKLLKLN-----HPPPQIMEVFKSNYNALNENEKSMFLDIACFFRG 270  

                   ekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHn
                   ek+dyV +l +        +G  vL+dK+L+ i         ++  eMHn
  gi|6598361   271 EKADYVMQLFEGC-GFFPHVGIYVLVDKCLVTIV--------KRKMEMHN 311  

                   LLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdn........TG
                   L q +G+  I  +  +   e   +  L D+  I   L+d++++ +++++G
  gi|6598361   312 LIQIVGKA-ISNEGTV---ELDRHVRLWDTSIIQPLLEDEetklkgesKG 357  

                   tgtrsVlGIslDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-
                   t  + +  I lD+s+++  +++  +AF+ M+NL+FL+iy +  ++++   
  gi|6598361   358 TT-EDIEVIFLDMSNLK--FFVKPDAFKSMHNLRFLKIYSSNPGKHQR   402  

                   *
                    
  gi|6598361     -   -    

gi|13509207|emb|CAC35321.1|: domain 1 of 1, from 209 to 600: score 87.3, E = 3.8e-21
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         d+lVGi+    +   LL Lds    +++GI G  G GKTT A+A
  gi|1350920   209    ---DELVGIDSRVDEVVGLLNLDSSTSEKIIGIHGMGGLGKTTLAKA 252  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    +++ S      +F+   F en+r                 l e +    
  gi|1350920   253 VYDKVS-----TKFERCYFLENIR---------------DTLSEKN--GV 280  

                   LhLQeqfLSkILnqk.........DikIhdHLGvieERLkdqKVLIiLDD
                     LQ++  S IL+++ ++ ++ +++i+I       ++R + +K LI+LDD
  gi|1350920   281 SILQNKIISGILRKDfneaknasdGIRII------RDRVCRHKLLIVLDD 324  

                   VDdleQLdALAketqWFGpGSRIIVTTeD...kqLLkaHgInhtIYeVgf
                   VD   Q d   ++ + F   SR  +TT D ++ +LL+ +       e + 
  gi|1350920   325 VDEKFQFDDVLGKLNNFSTNSRFLITTRDargLELLQEYKMFE-LQEMS- 372  

                   PSkeeALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsL
                      ++ L+ F  +AF  + Pp ++  L ++e++  a  LPL  +V GS L
  gi|1350920   373 --PDHSLTLFNKHAFDVDCPPKDYAIL-SKEFVQAAAGLPLYIKVIGSLL 419  

                   RGkskeeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIA
                    +++k  We+ L ++++        k+++ L++sY++L ++++ +FL IA
  gi|1350920   420 FRMDKIFWEEKLEEFKK----ISPTKVQERLKISYNELTHNEKQIFLDIA 465  

                   CfFNgekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgt
                   C F g+   y   + +d  +   +     L ++SLI+  + + + +v  t
  gi|1350920   466 CYFIGSQKIYPIFMWEDC-DFYPESTIRSLIQRSLIKLQRSRIKGDVLNT 514  

                   ieMHnLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgt
                     MH+    LGR  IVr++++  ++P KR      ++  + L +++Gt +
  gi|1350920   515 FWMHDHIIDLGRA-IVREEKN--QNPYKRSRIWSNKDAVNMLKHKKGTDC 561  

                   rsVlGIslDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                     Vl    D+ + +  l+   k Fe+++ L++L++ +   r +g    
  gi|1350920   562 VEVL--TVDMEGED--LILTNKEFEKLTMLRYLKVSNA--RLAGD    600  

gi|13509234|emb|CAC35337.1|: domain 1 of 1, from 209 to 600: score 87.2, E = 4e-21
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         d+lVGi+    +   LL Lds    +++GI G  G GKTT A+A
  gi|1350923   209    ---DELVGIDSLVDEVVGLLNLDSSASEKIIGIHGMGGLGKTTLAKA 252  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    +++ +      +F+   F en+r                 l e +    
  gi|1350923   253 VYDKVF-----TRFERCFFLENIR---------------DTLSEKN--GV 280  

                   LhLQeqfLSkILnqk.........DikIhdHLGvieERLkdqKVLIiLDD
                   L  Q++  S IL+++ ++ +  +++i+I       ++R + +K LI+LDD
  gi|1350923   281 LIMQNKIISGILRKDfneakyasdGIRII------RDRVCRHKLLIVLDD 324  

                   VDdleQLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSk
                   VD   Q d   ++ + F   SR  +TT D   L+  +    + e    S 
  gi|1350923   325 VDEKFQFDEVLGKLNNFSMDSRFLITTRDARGLELLRECK-MFELQEMSP 373  

                   eeALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGk
                   ++ L+ F   AFg  +Pp+++  L ++e++  a  LPL  +V GS L ++
  gi|1350923   374 DHSLTLFNKNAFGAEFPPEDYAIL-SNEFVQAAAGLPLYIKVIGSLLFRM 422  

                   skeeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfF
                   +k  We+ L +L++        k+++ L++sY++L ++++ +FL IAC F
  gi|1350923   423 DKIFWEEKLEELKK----ISPTKVQERLKISYNELTHNEKQIFLDIACYF 468  

                   NgekvdyVkalLadsnnLDV..rqGLkvLadKSLIhisplgnedkvdgti
                    g   ++++  L  s + D  ++     L+++SLI+  + + + +   t 
  gi|1350923   469 IG--LSKIEPILMWS-DCDFypESTIRYLTQRSLIKLQRSEVKGDDINTF 515  

                   eMHnLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtr
                    MHn  + LGR  IVr++ +  ++P KR      ++  d L +++Gt + 
  gi|1350923   516 QMHNHVRDLGRA-IVREENN--QNPYKRSRIWSNKDAIDMLKHKKGTDCV 562  

                   sVlGIslDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                    Vl    D+ + +  l+   k +e+++ L++L++ +   r +g    
  gi|1350923   563 EVL--TVDMEGED--LILTNKELEKLTRLRYLSVSNA--RLAGD    600  

gi|13509238|emb|CAC35339.1|: domain 1 of 1, from 209 to 600: score 86.6, E = 6.3e-21
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         d+lVGi+    +   LL Lds    +++GI G  G GKTT A+A
  gi|1350923   209    ---DELVGIDSRVDEVVGLLNLDSSTSEKIIGIHGMGGLGKTTLAKA 252  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    +++ S      +F+   F en+r                 l e +    
  gi|1350923   253 VYDKVS-----TKFERCYFLENIR---------------DTLSEKN--GV 280  

                   LhLQeqfLSkILnqk.........DikIhdHLGvieERLkdqKVLIiLDD
                     LQ++  S IL+++ ++ ++ +++i+I       ++R + +K LI+LDD
  gi|1350923   281 SILQNKIISGILRKDfneaknasdGIRII------RDRVCRHKLLIVLDD 324  

                   VDdleQLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSk
                   VD   Q d   ++ + F   SR  +TT D   L+  +    + e    S 
  gi|1350923   325 VDEKFQFDEVLGKLNNFSMDSRFLITTRDARGLELLRECK-MFELQEMSP 373  

                   eeALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGk
                   ++ L+ F   AFg  +Pp+++  L ++e++  a  LPL  +V GS L ++
  gi|1350923   374 DHSLTLFNKNAFGAEFPPEDYAIL-SNEFVQAAAGLPLYIKVIGSLLFRM 422  

                   skeeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfF
                   +k  We+ L ++++        k+++ L++sY +L  +++ +FL IAC F
  gi|1350923   423 DKIFWEEKLEEFKK----ISPTKVQERLKISYTELTYNEKQIFLDIACYF 468  

                   NgekvdyVkalLadsnnLDV..rqGLkvLadKSLIhisplgnedkvdgti
                    g+   +++ +   s + D  ++     L+++SLI+  + + + +   t 
  gi|1350923   469 IGSY--KIEPMRMWS-DCDFypESTIRYLTQRSLIKLQRSEVKGDDINTF 515  

                   eMHnLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtr
                    MHn  + LGR  IVr++ +  ++P KR      ++  d L +++Gt + 
  gi|1350923   516 QMHNHVRDLGRA-IVREENN--QNPYKRSRIWSNKDAIDMLKHKKGTDCV 562  

                   sVlGIslDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                    Vl    D+ + +  l+   k +e+++ L++L++ +   r +g    
  gi|1350923   563 EVL--TVDMEGED--LILTNKELEKLTRLRYLSVSNA--RLAGD    600  

gi|13509236|emb|CAC35338.1|: domain 1 of 1, from 209 to 600: score 85.1, E = 1.7e-20
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         d+lVGi+ H  +   LL Lds    +++GI G  G GKTT A+A
  gi|1350923   209    ---DELVGIDSHVDEVVRLLNLDSSTSEKIIGIHGMGGLGKTTLAKA 252  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    +++ S      +F+   F en+r                 l e +    
  gi|1350923   253 VYDKVS-----TKFERCYFLENIR---------------DTLLEKN--GV 280  

                   LhLQeqfLSkILnqk.........DikIhdHLGvieERLkdqKVLIiLDD
                     LQ++  S IL+++ ++ ++ +++i+I       ++R + +K LI+LDD
  gi|1350923   281 SILQNKIISGILRKDfneaknasdGIRII------RDRVCRHKLLIVLDD 324  

                   VDdleQLdALAketqWFGpGSRIIVTTeD...kqLLkaHgInhtIYeVgf
                   VD   Q d   ++ + F   SR  +TT D ++ +LL+       + e   
  gi|1350923   325 VDEKFQFDDVLGKFENFSTDSRFLITTRDvrgLELLRE---CK-MFELQE 370  

                   PSkeeALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsL
                    S ++ L+ F  +AFg +sP++++  L ++ +   a  LPL  +V GS L
  gi|1350923   371 MSPDHSLTLFNKHAFGVDSPQEDYAIL-SKDFSQAAAGLPLYIKVIGSLL 419  

                   RGkskeeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIA
                    +++k  We+ L +L++        k+++ L++sY++L + +  +FL IA
  gi|1350923   420 YRMDKIFWEEKLEELKK----ISPTKVQERLKISYNELTHTERQIFLDIA 465  

                   CfFNgekvdyVkalLadsnnLDV..rqGLkvLadKSLIhisplgned.kv
                   C F ++   ++  +L  + + D  ++     L+++SLI+    + + + +
  gi|1350923   466 CYFIESF--KIGPMLMWN-DCDFysESTIRSLTQRSLIKLQ--KPYIkGA 510  

                   .dgtieMHnLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnT
                   + +   MH+  + LGR  IVr++++  ++P KR      ++  d L +++
  gi|1350923   511 dIDMFWMHDHVRDLGRA-IVREEKN--QNPYKRSRIWSNKDAVDMLKHKK 557  

                   GtgtrsVlGIslDtseieeelnIsekAFegMrNLqFLriykksfrddgk<
                   Gt    V     D+   +  ++  +k Fe+++ L++L++ +   r +g  
  gi|1350923   558 GTD--WVEILEVDMKFED--FMLTDKEFEKLTRLRYLKVSNG--RLAGD  600  

                   -*
                     
  gi|1350923     -    -    

gi|13517474|gb|AAK28809.1|AF310962_1: domain 1 of 1, from 178 to 609: score 84.9, E = 2.1e-20
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         ++lV ++  + + + LL +d  d+  ++G wG  G+GKTT A A
  gi|1351747   178    ---NNLVAMGSRIFEVERLLAMDKLDDTCIIGLWGMGGVGKTTLAEA 221  

                   LfsqLSerhFq.ssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGm
                    +++       +++ + + F+ n+ ++            ++g+D      
  gi|1351747   222 CYDRVT----SsNKGIKHLFIRNVNEMC---------EKHHGVDKIV--H 256  

                   KLhLQeqfLSkILnqkDikIhdHLGvi..eERLkdqKVLIiLDDVDdleQ
                   KL       Sk+L+ ++i  + +L  + ++ERL   +V+++LD V+ leQ
  gi|1351747   257 KLY------SKLLDENNIDRE-DLNIAyrRERLSRLRVFVVLDNVETLEQ 299  

                   LdALA.....ketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSke
                   L+ LA +   + ++ F  GSRII+TT +k+ L +      IY V+   +e
  gi|1351747   300 LEKLAlgyvfNLSKVFAAGSRIIITTRNKKVL-QNAMAK-IYNVECLNDE 347  

                   eALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGks
                   e    F ++AF+Q+ P+d  +   ++  t  +   PL+L++lG +L  ++
  gi|1351747   348 ESIRLFSLHAFKQDRPQDNWMGK-SCLATSYCKGNPLALKILGGALFDED 396  

                   keeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFN
                    ++W+ +L  Lr     s +   e +Lr sYD+L ++++ +F  +AC+  
  gi|1351747   397 VHYWKSLLTGLRQ----SGNLGMETILRRSYDKLGKEEKKIFMDVACLLY 442  

                   gekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMH
                   g+ ++++ ++ a        +  k L dKSL    p +n     + ie H
  gi|1351747   443 GMSRSRLIDYMATM-YSSSYVKVKDLIDKSLLTCVPSEN----GEMIEVH 487  

                   nLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgt....
                   +LL +++   IV ++ +     gKR  LvD+ + +  L+      ++++ 
  gi|1351747   488 DLLKEMAWN-IVKEEPK----LGKRSRLVDPDDVHKLLSTSEVKNWstsi 532  

                   .................................rsVlGIslDtseieeel
                    +  ++     +++++++ ++ +++++++ +++r+  GI+lD+s+++ e 
  gi|1351747   533 vnlfkgivmvipkrkkrkvtdmhqkgddpleehRTTEGIRLDLSKTK-EM 581  

                   nIsekAFegMrNLqFLriykksfrddgk<-*
                   +   +AFegM  L FL++     ++  +   
  gi|1351747   582 YLKANAFEGMNSLTFLKFESPEIKYPRY    609  

gi|13509219|emb|CAC35329.1|: domain 1 of 1, from 209 to 600: score 83.8, E = 4.3e-20
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         d+lVGi+    +   LL Lds    +++GI G  G GKTT A+A
  gi|1350921   209    ---DELVGIDSLVDEVVGLLNLDSSTSEKIIGIHGMGGLGKTTLAKA 252  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    +++ S      +F+   F en+r                 l e +    
  gi|1350921   253 VYDKVS-----TKFERCYFLENIR---------------DTLSEKN--GV 280  

                   LhLQeqfLSkILnqk.........DikIhdHLGvieERLkdqKVLIiLDD
                     LQ++  S IL+++ ++ ++ +++i+I       ++R + +K LI+LDD
  gi|1350921   281 SILQNKIISGILRKDfneaknasdGIRII------RDRVCRHKLLIVLDD 324  

                   VDdleQLdALAketqWFGpGSRIIVTTeD...kqLLkaHgInhtIYeVgf
                   VD   Q d   ++ + F   SR  +TT D ++ +LL+ +       e + 
  gi|1350921   325 VDEKFQFDDVLGKLNNFSTNSRFLITTRDargLELLQEYKMFE-LQEMS- 372  

                   PSkeeALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsL
                      ++ L+ F  +AF  + Pp ++  L ++e++  a  LPL  +V GS L
  gi|1350921   373 --PDHSLTLFNKHAFDVDCPPKDYAIL-SKEFVQAAAGLPLYIKVIGSLL 419  

                   RGkskeeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIA
                    +++k  We+ L ++++        k+++ L++sY++L  +++ +FL IA
  gi|1350921   420 FRMDKIFWEEKLEEFKK----ISPTKVQERLKISYNELTYNEKQIFLDIA 465  

                   CfFNgekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgt
                   C F g+       +  d  +L  +     L+++SLI+  + + + +   t
  gi|1350921   466 CYFIGSVKIEPILMWNDC-DLYPESTIRSLTQRSLIKLQRSEMKGDDVNT 514  

                   ieMHnLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgt
                     MH+  + LGR  IVr++ +  ++P KR      ++  d L +++Gt +
  gi|1350921   515 FQMHDHVRDLGRA-IVREENN--QKPYKRSRIWSNKDAIDMLKHKKGTDC 561  

                   rsVlGIslDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                     Vl    D+ + +  l+   k +e+++ L++L++ +   r +g    
  gi|1350921   562 VEVL--TVDMEGED--LILTNKELEKLTRLRYLSVSNA--RLAGD    600  

gi|13509221|emb|CAC35330.1|: domain 1 of 1, from 209 to 600: score 83.6, E = 5e-20
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         d+lVGi+    +   LL Lds    +++GI G  G GKTT A+A
  gi|1350922   209    ---DELVGIDSRVDEVVGLLNLDSSTSEKIIGIHGMGGLGKTTLAKA 252  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    +++ S      +F+   F en+r                 l e +    
  gi|1350922   253 VYDKVS-----TKFERCYFLENIR---------------DTLSEKN--GV 280  

                   LhLQeqfLSkILnqk.........DikIhdHLGvieERLkdqKVLIiLDD
                     LQ++  S IL+++ ++ ++ +++i+I       ++R + +K LI+LDD
  gi|1350922   281 SILQNKIISGILKKDfneaknasdGIRII------RDRVCRHKLLIVLDD 324  

                   VDdleQLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSk
                   VD   Q d   ++ + F   SR  +TT D   L+  +    + e    S 
  gi|1350922   325 VDEKFQFDEVLGKLNNFSMDSRFLITTRDARGLELLRECK-MFELQEMSP 373  

                   eeALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGk
                   ++ L+ F   AFg ++Pp ++  L ++e++  a  LPL  +V GS L ++
  gi|1350922   374 DHSLTLFNKNAFGVDFPPKDYAIL-SNEFVQAAAGLPLYIKVIGSLLFRM 422  

                   skeeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfF
                   +k  We+ L ++++        k+++ L++sY++L  +++ +FL IAC F
  gi|1350922   423 DKIFWEEKLEEFKK----ISPTKVQERLKISYNELTYNEKQIFLDIACYF 468  

                   NgekvdyVkalLadsnnLDV..rqGLkvLadKSLIhisplgnedkvdgti
                    g+   +++ +   s + D  ++     L ++SLI++ + + + ++  t 
  gi|1350922   469 IGSY--KIEPMRMWS-DCDFypESTIRSLIQRSLIKFQRSRIKSDILNTF 515  

                   eMHnLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtr
                    MH+    LGR  IVr++ +  ++P KR      ++  d L +++Gt + 
  gi|1350922   516 WMHDHIIDLGRA-IVREENN--KKPYKRSRIWSNKDAIDMLKHKKGTDCV 562  

                   sVlGIslDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                    Vl    D+ + +  l+   k +e+++ L++L++ +   r +g    
  gi|1350922   563 EVL--TVDMEGED--LILTNKELEKLTRLRYLSVSNA--RLAGD    600  

gi|13517464|gb|AAK28803.1|AF310958_1: domain 1 of 1, from 180 to 610: score 81.4, E = 2.3e-19
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         ++lV ++  + + + LL +d  d+  ++G wG  G+GKTT A A
  gi|1351746   180    ---NNLVAMGSRIFEVERLLAMDKLDDTCIIGLWGMGGVGKTTLAEA 223  

                   LfsqLSerhFq.ssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGm
                    +++       +++ + + F+ n+ ++            ++g+D      
  gi|1351746   224 CYDRVT----SsNKGIKHLFIRNVNEMC---------EKHHGVDKIV--H 258  

                   KLhLQeqfLSkILnqkDikIhdHLGvi..eERLkdqKVLIiLDDVDdleQ
                   KL       Sk+L+ ++i  + +L  + ++ERL   +V+++LD V+ leQ
  gi|1351746   259 KLY------SKLLDENNIDRE-DLNIAyrRERLSRLRVFVVLDNVETLEQ 301  

                   LdALA.....ketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSke
                   L+ LA +   + ++ F  GSRII+TT +k+ L +      IY V+   ++
  gi|1351746   302 LEKLAlgyvfNLSKVFAAGSRIIITTRNKKVL-QNAMAK-IYNVECLNDK 349  

                   eALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGks
                   e    F ++AF+Q+ P+d  +   +r  t  +   PL+L++lG +L  ++
  gi|1351746   350 ESIRLFSLHAFKQDRPQDNWMGK-SRLATSYCKGNPLALKILGGALFDED 398  

                   keeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFN
                    ++W+ +L  Lr     s +   e +Lr sYD+L ++++ +F  +AC+  
  gi|1351746   399 VHYWKSLLTGLRQ----SGNLGMETILRRSYDKLGKEEKKIFMDVACLLY 444  

                   gekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMH
                   g+ ++++ ++ a        +  k L dKSL    p +n     + ie H
  gi|1351746   445 GMSRSRLIDYMATM-YSSSYVKVKDLIDKSLLTCVPSEN----GEMIEVH 489  

                   nLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgt....
                   +LL +++   IV ++ +     gKR  LvD+ + +  L+     +++++ 
  gi|1351746   490 DLLKEMAWN-IVKEEPK----LGKRSRLVDPDDVHKLLSTSEVKSWstsi 534  

                   .................................rsVlGIslDtseieeel
                    +  ++     +++++++ ++ ++++ ++ +++r+  GI lD+s+++ e 
  gi|1351746   535 vnlfkgivmviprrkrrkvtdmhekgydpleehRTTEGICLDLSGTK-EM 583  

                   nIsekAFegMrNLqFLriykksfrddgk<-*
                   +   +AFegM  L FL++    ++  +    
  gi|1351746   584 YLKANAFEGMNSLTFLKFELP-EIELPR    610  

gi|13517466|gb|AAK28804.1|AF310959_1: domain 1 of 1, from 178 to 608: score 81.4, E = 2.3e-19
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         ++lV ++  + + + LL +d  d+  ++G wG  G+GKTT A A
  gi|1351746   178    ---NNLVAMGSRIFEVERLLAMDKLDDTCIIGLWGMGGVGKTTLAEA 221  

                   LfsqLSerhFq.ssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGm
                    +++       +++ + + F+ n+ ++            ++g+D      
  gi|1351746   222 CYDRVT----SsNKGIKHLFIRNVNEMC---------EKHHGVDKIV--H 256  

                   KLhLQeqfLSkILnqkDikIhdHLGvi..eERLkdqKVLIiLDDVDdleQ
                   KL       Sk+L+ ++i  + +L  + ++ERL   +V+++LD V+ leQ
  gi|1351746   257 KLY------SKLLDENNIDRE-DLNIAyrRERLSRLRVFVVLDNVETLEQ 299  

                   LdALA.....ketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSke
                   L+ LA +   + ++ F  GSRII+TT +k+ L +      IY V+   ++
  gi|1351746   300 LEKLAlgyvfNLSKVFAAGSRIIITTRNKKVL-QNAMAK-IYNVECLNDK 347  

                   eALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGks
                   e    F ++AF+Q+ P+d  +   +r  t  +   PL+L++lG +L  ++
  gi|1351746   348 ESIRLFSLHAFKQDRPQDNWMGK-SRLATSYCKGNPLALKILGGALFDED 396  

                   keeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFN
                    ++W+ +L  Lr     s +   e +Lr sYD+L ++++ +F  +AC+  
  gi|1351746   397 VHYWKSLLTGLRQ----SGNLGMETILRRSYDKLGKEEKKIFMDVACLLY 442  

                   gekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMH
                   g+ ++++ ++ a        +  k L dKSL    p +n     + ie H
  gi|1351746   443 GMSRSRLIDYMATM-YSSSYVKVKDLIDKSLLTCVPSEN----GEMIEVH 487  

                   nLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgt....
                   +LL +++   IV ++ +     gKR  LvD+ + +  L+     +++++ 
  gi|1351746   488 DLLKEMAWN-IVKEEPK----LGKRSRLVDPDDVHKLLSTSEVKSWstsi 532  

                   .................................rsVlGIslDtseieeel
                    +  ++     +++++++ ++ ++++ ++ +++r+  GI lD+s+++ e 
  gi|1351746   533 vnlfkgivmviprrkrrkvtdmhekgydpleehRTTEGICLDLSGTK-EM 581  

                   nIsekAFegMrNLqFLriykksfrddgk<-*
                   +   +AFegM  L FL++    ++  +    
  gi|1351746   582 YLKANAFEGMNSLTFLKFELP-EIELPR    608  

gi|6598362|gb|AAF18600.1|AC002354_9: domain 1 of 1, from 122 to 521: score 79.9, E = 6.7e-19
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                          +lVG+   l+++k  L+L  k e r+VG+ G +GIGKTT  + 
  gi|6598362   122    ----ELVGLSQRLKELKEKLDLSRK-ETRIVGVLGMPGIGKTTLVKR 163  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L++ +      ++Fq +  m n+r                 + eY+    
  gi|6598362   164 LYDEWK-----HNFQRHLHMVNIR---------------QKSKEYG---T 190  

                   LhLQeqfLSkIL..nqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQL
                    +L+++ L ++L++  +Di  +     +++ L  +KVL++LDDV   +Q 
  gi|6598362   191 HSLERMILKELLsdTYNDITEEMTYASVKDELLKKKVLLVLDDVSSKKQI 240  

                   dALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIF
                     L +  +W   GSRI++TT Dk    +++  +t Y V      + L+ F
  gi|6598362   241 QGLLGNLNWIRKGSRIVITTRDKISISQFE--YT-YVVPRLNITDGLKQF 287  

                   CrsAFg.QnsPpdG.FeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                     +AF ++n P+ G+ ++L + +++  a   PL+L++lG  L   +k+ W
  gi|6598362   288 SFYAFEdHNCPYPGnLMDL-STKFVDYARGNPLALKILGRELLSIDKDQW 336  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFN.gek
                    + L  L       +   I++ Lr sYD+L+++ ++ FL +A+fF +g +
  gi|6598362   337 PKRLDTLAQ---LPI-PYIQDLLRASYDDLSNQQKEVFLVVAWFFGsGDE 382  

                   vdyVkalLa....dsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieM
                     y+ +l  ++++ds   D        a   LI+is         g+ eM
  gi|6598362   383 -YYIRSLVDtedpDS-ADDAASEVRDFAGNLLISIS--------SGRLEM 422  

                   HnLLqqLGReAIVrk...............QsidhdePgKRqFLvDaeeI
                   H+L   ++++  +   +++++ + +   +++s+      KR   v+    
  gi|6598362   423 HDLMATFAKK-LCSSlsnennygyqmiwnhESFNAAAKNKRMRYVNQP-- 469  

                   cdVLtdnTGtgtrsVlGIslDtseieeelnIsekAFegMrNLqFLriykk
                   +   t+   +    V+GI lD+se+++    + k F  M+NL++L++y++
  gi|6598362   470 RKKVTESEMDN---VMGILLDVSEMDNNMTLDSKFFSEMCNLRYLKVYNS 516  

                   sfrddgk<-*
                     +++     
  gi|6598362   517 --QCSRD    521  

gi|13509227|emb|CAC35333.1|: domain 1 of 1, from 209 to 600: score 79.2, E = 1.1e-18
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         d+lVGi+    +   LL Lds    +++GI G  G GKTT A+A
  gi|1350922   209    ---DELVGIDSPVDEVVGLLNLDSSASEKIIGIHGMGGLGKTTLAKA 252  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    +++ +      +F+   F en+r                 l e +    
  gi|1350922   253 VYDKVF-----TRFERCFFLENIR---------------DTLSEKN--GV 280  

                   LhLQeqfLSkILnqk.........DikIhdHLGvieERLkdqKVLIiLDD
                   L  Q++  S IL+++ ++ +  +++i+I       ++R + +K LI+LDD
  gi|1350922   281 LIMQNKIISGILRKDfneakyasdGIRII------RDRVCRHKLLIVLDD 324  

                   VDdleQLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSk
                   VD   Q d   ++   F   SR  +TT D   L+  +    + e    S 
  gi|1350922   325 VDEKFQFDEVLGKLDNFSMDSRFLITTRDARGLELLRECK-MFELQEMSP 373  

                   eeALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGk
                   ++ L+ F   AFg + Pp+++  L ++e++  a  LPL  +V GS L  +
  gi|1350922   374 DHSLTLFNKNAFGVDCPPEDYAIL-SKEFVQAAAGLPLYIKVIGSLLFCM 422  

                   skeeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfF
                   +k  We+ L +L++        k+++ L++sY++L ++++ +FL IAC F
  gi|1350922   423 DKIFWEEKLEELKK----ISPTKVQERLKISYNELTHNEKQIFLDIACYF 468  

                   NgekvdyVkalLadsnnLDV..rqGLkvLadKSLIhisplgnedkvdgti
                    g   ++++  L  s + D  ++     L+++SLI+  + + + +   t 
  gi|1350922   469 IG--LSKIEPILMWS-DCDFypESTIRYLTQRSLIKLQRSEVKGDDINTF 515  

                   eMHnLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtr
                    MHn  + LGR  IVr++ +  ++P KR      ++  d L +++Gt + 
  gi|1350922   516 QMHNHVRDLGRA-IVREENN--QNPYKRSRIWSNKDAIDMLKHKKGTDCV 562  

                   sVlGIslDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                    Vl    D+ + +  l+   k +e+++ L++L++ +   r +g    
  gi|1350922   563 EVL--TVDMEGED--LILTNKELEKLTRLRYLSVSNA--RLAGD    600  

gi|9759605|dbj|BAB11393.1|: domain 1 of 1, from 210 to 598: score 78.2, E = 2.1e-18
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                       D   l GiE   e +k  L L+s++  r +G+ G +GIGKTT A+ 
  gi|9759605   210    SDDSLLHGIETRVEQLKEKLELKSENVTRFIGVVGMPGIGKTTLAKR 256  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   Lfs        + F ++ F + ++           ++ p  lDe      
  gi|9759605   257 LFSECG-----KHFLHKMFLDDVSQ----------KPEP-FLDE------ 284  

                   LhLQeqfLSkILnqkD.......ikIhdHLGvieERLkdqKVLIiLDDVD
                     L+  +L  + + k++++++++ k +     i+  L+ +KV+++LD V 
  gi|9759605   285 -TLHTDLLLGLWKSKNngrdgnrAKLS--IDYIKTQLQGKKVFVVLDNVG 331  

                   dleQLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkee
                   d  Q d + +   W   GSRI++TT  k   +  g n t Y V   S  +
  gi|9759605   332 DKSQIDKILGGCDWIKAGSRIVITTSSKSVIQ--GLNST-YLVPGLSSCD 378  

                   ALqIFCrsAFgQnsPpdGFe.....eLeAreVtkLaGnLPLGLrVlGSsL
                   AL  F  +AF   s+ dGF++++ ++L A++++      P  L+ l   L
  gi|9759605   379 ALNHFNYHAF---SASDGFYqpsftDL-AKQFVDYSMGHPSVLKLLAREL 424  

                   RGkskeeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIA
                   R k++ +W++ L  L +    s    I++vLr+ YD+L e+++  FL IA
  gi|9759605   425 RSKDESYWKEKLSALAN----SPSNTIQDVLRIPYDELKEQHKIVFLDIA 470  

                   CfFNgekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgt
                    fF+ e+ +yV  lL+ s   D +   + LadK LI is         ++
  gi|9759605   471 YFFRFENESYVRRLLGSSAHADAS-EITDLADKFLIDIS--------GDR 511  

                   ieMHnLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgt
                   +eM++LL  ++      + s + +   +R+ L    eI dVL ++     
  gi|9759605   512 VEMNDLLYTFAIG-LNSQASSE-NTTSERR-LSKHSEIVDVLMNKAEAT- 557  

                   rsVlGIslDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                    +V G  lD+ e++ e   + + F +M +L++L++y++   ++ +   
  gi|9759605   558 -KVRGVYLDMFEVK-EMGLDSDTFNKMDDLRYLKFYNS--HCHRE    598  

gi|13517468|gb|AAK28805.1|AF310960_1: domain 1 of 1, from 180 to 607: score 76.9, E = 5.3e-18
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         ++lV ++  + + + LL +d  d+  ++G w   G+GKTT A A
  gi|1351746   180    ---NNLVAMGSRIFEVERLLAMDKLDDTCIIGLWEMGGVGKTTLAEA 223  

                   LfsqLSerhFq.ssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGm
                    +++       +++ + + F+ n+ +              ++   ++   
  gi|1351746   224 CYDRVT----SsNKGIKHLFVRNVNE--------------ICEKHHG-VE 254  

                   KLhLQeqfLSkILnqkDikIhdHL..GvieERLkdqKVLIiLDDVDdleQ
                   K     ++ Sk+L+ ++i  + +L+ G  +ERL   +V+++LD V+ leQ
  gi|1351746   255 KIV--HKLYSKLLDENNIDRE-DLniGYRRERLSRSRVFVVLDNVETLEQ 301  

                   L.........dALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgf
                   L  +   + +++ A        GSRII+TT +k+ L +      IY V+ 
  gi|1351746   302 LalgyvfnlsKVFAA-------GSRIIITTRNKKVL-QNAMAK-IYNVEC 342  

                   PSkeeALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsL
                     +ee    F ++AF+Q+ P+d  +   +r  t  +   PL+L++lG +L
  gi|1351746   343 LNDEESTRLFSLHAFKQDRPQDNWMGK-SRLATSYCKGNPLALKILGGAL 391  

                   RGkskeeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIA
                    G++ ++W   L  Lr       +  Ie++Lr sYD+L ++++ +F  +A
  gi|1351746   392 YGEDIHYWRSFLTGLRQ----PGNLGIENILRRSYDKLGKEEKKIFMDVA 437  

                   CfFNgekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgt
                   C+  g+ ++++ ++ a        ++ k L dKSL    + +ne    + 
  gi|1351746   438 CLLYGMSRSRLIDYMATM-YSSSYVRVKDLIDKSLLTCVSSKNE----DK 482  

                   ieMHnLLqqLGReAIVrk................................
                   ie H+LL +++   IV ++++ +++++  ++++ ++  ++++ ++ +++ 
  gi|1351746   483 IEVHDLLKEMAWN-IVKEepklgkrsrlvdpddvhkllstsevknwstsi 531  

                   ........QsidhdePgKRqFLvDaee.IcdVLtdnTGtgtrsVlGIslD
                    +  ++    i     +KR+  +D +e+ +d L+++  t+     GI lD
  gi|1351746   532 vnlfkgivMVI---PRRKRRKVTDMHEkGYDPLEEHRTTE-----GICLD 573  

                   tseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   +s+++ e +   +AFegM  L FL++    +++ ++   
  gi|1351746   574 LSGTK-EMCLKANAFEGMNSLTFLKFESP-EIKYPH    607  

gi|13517472|gb|AAK28808.1|AF310961_1: domain 1 of 1, from 180 to 607: score 76.9, E = 5.3e-18
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         ++lV ++  + + + LL +d  d+  ++G w   G+GKTT A A
  gi|1351747   180    ---NNLVAMGSRIFEVERLLAMDKLDDTCIIGLWEMGGVGKTTLAEA 223  

                   LfsqLSerhFq.ssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGm
                    +++       +++ + + F+ n+ +              ++   ++   
  gi|1351747   224 CYDRVT----SsNKGIKHLFVRNVNE--------------ICEKHHG-VE 254  

                   KLhLQeqfLSkILnqkDikIhdHL..GvieERLkdqKVLIiLDDVDdleQ
                   K     ++ Sk+L+ ++i  + +L+ G  +ERL   +V+++LD V+ leQ
  gi|1351747   255 KIV--HKLYSKLLDENNIDRE-DLniGYRRERLSRSRVFVVLDNVETLEQ 301  

                   L.........dALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgf
                   L  +   + +++ A        GSRII+TT +k+ L +      IY V+ 
  gi|1351747   302 LalgyvfnlsKVFAA-------GSRIIITTRNKKVL-QNAMAK-IYNVEC 342  

                   PSkeeALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsL
                     +ee    F ++AF+Q+ P+d  +   +r  t  +   PL+L++lG +L
  gi|1351747   343 LNDEESTRLFSLHAFKQDRPQDNWMGK-SRLATSYCKGNPLALKILGGAL 391  

                   RGkskeeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIA
                    G++ ++W   L  Lr       +  Ie++Lr sYD+L ++++ +F  +A
  gi|1351747   392 YGEDIHYWRSFLTGLRQ----PGNLGIENILRRSYDKLGKEEKKIFMDVA 437  

                   CfFNgekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgt
                   C+  g+ ++++ ++ a        ++ k L dKSL    + +ne    + 
  gi|1351747   438 CLLYGMSRSRLIDYMATM-YSSSYVRVKDLIDKSLLTCVSSKNE----DK 482  

                   ieMHnLLqqLGReAIVrk................................
                   ie H+LL +++   IV ++++ +++++  ++++ ++  ++++ ++ +++ 
  gi|1351747   483 IEVHDLLKEMAWN-IVKEepklgkrsrlvdpddvhkllstsevknwstsi 531  

                   ........QsidhdePgKRqFLvDaee.IcdVLtdnTGtgtrsVlGIslD
                    +  ++    i     +KR+  +D +e+ +d L+++  t+     GI lD
  gi|1351747   532 vnlfkgivMVI---PRRKRRKVTDMHEkGYDPLEEHRTTE-----GICLD 573  

                   tseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   +s+++ e +   +AFegM  L FL++    +++ ++   
  gi|1351747   574 LSGTK-EMCLKANAFEGMNSLTFLKFESP-EIKYPH    607  

gi|13509229|emb|CAC35334.1|: domain 1 of 1, from 209 to 600: score 76.8, E = 5.7e-18
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         d+lVGi+ H  +   LL Lds    +++GI G  G GKTT A+A
  gi|1350922   209    ---DELVGIDSHVDEVVRLLNLDSSTSEKIIGIHGMGGLGKTTLAKA 252  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    +++ S      +F+   F en+r                 l e +    
  gi|1350922   253 VYDKVS-----TKFERCYFLENIR---------------DTLLEKN--GV 280  

                   LhLQeqfLSkILnqk.........DikIhdHLGvieERLkdqKVLIiLDD
                     LQ++  S IL+++ ++ ++ +++i+I       ++R + +K LI+LDD
  gi|1350922   281 SILQNKIISGILRKDfneaknasdGIRII------RDRVCRHKLLIVLDD 324  

                   VDdleQLdALAketqWFGpGSRIIVTTeD...kqLLkaHgInhtIYeVgf
                   VD   Q d   ++ + F   SR  +TT D ++ +LL+       + e   
  gi|1350922   325 VDEKFQFDDVLGKFENFSTDSRFLITTRDvrgLELLRE---CK-MFELQE 370  

                   PSkeeALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsL
                    S ++ L+ F  +AFg +sP++++  L ++ +   a  LPL  +V GS L
  gi|1350922   371 MSPDHSLTLFNKHAFGVDSPQEDYAIL-SKDFSQPAAGLPLYIKVIGSLL 419  

                   RGkskeeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIA
                    +++k  We+ L +L++        k+++ L++sY++L + +  +FL  A
  gi|1350922   420 YRMDKIFWEEKLEELKK----ISPTKVQERLKISYNELTHTERQIFLDXA 465  

                   CfFNgekvdyVkalLadsnnLDV..rqGLkvLadKSLIhisplgned.kv
                   C F ++   ++  +L  + + D  ++     L+++SLI+    + + + +
  gi|1350922   466 CYFIESF--KIGPMLMWN-DCDFysESTIRSLTQRSLIKLQ--KPYIkGA 510  

                   .dgtieMHnLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnT
                   + +   MH+  + LGR  IVr++++  ++P KR      ++  d L +++
  gi|1350922   511 dIDMFWMHDHVRDLGRA-IVREEKN--QNPYKRSRIWSNKDAVDMLKHKK 557  

                   GtgtrsVlGIslDtseieeelnIsekAFegMrNLqFLriykksfrddgk<
                   Gt    V     D+   +  ++  +k Fe+++ L++L++ +   r +g  
  gi|1350922   558 GTD--WVEILEVDMKFED--FMLTDKEFEKLTRLRYLKVSNG--RLAGD  600  

                   -*
                     
  gi|1350922     -    -    

gi|8778463|gb|AAF79471.1|AC022492_15: domain 1 of 1, from 173 to 508: score 70.9, E = 2.4e-16
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                       DF +l G++ H++++  LL L+s++ Vr +GIwG++G+GKTT AR 
  gi|8778463   173    SDFKGLAGMDRHMKALYALLALESDEKVRTIGIWGSSGVGKTTLARY 219  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    +  +S      +Fq ++F en+                      +  mK
  gi|8778463   220 TYAEIS-----VKFQAHVFLENVE---------------------N--MK 241  

                   LhL..QeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQL
                     L + e+f  + L+  + + +     +++  k++KVL+i D+V+++eQ 
  gi|8778463   242 EMLlpSENFEGEDLRSVNHEMN-EMAEAKQ--KHRKVLLIADGVNNIEQG 288  

                   dALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIF
                   + +A  ++WF pGSR+I +T+ k LL + g+nh +YeVg    +eALq F
  gi|8778463   289 KWIAENANWFAPGSRVILITQEKSLLVQSGVNH-VYEVGSLRYDEALQLF 337  

                   CrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWed
                    r AF+Q  P  +Fe L +++ + LaG LP   r  GS L G++keeWe 
  gi|8778463   338 SRFAFKQPYPSPDFERL-SVRAVQLAGFLPVTIRLFGSFLTGRDKEEWEA 386  

                   mLpRLrtsfg....nsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNge
                   +L  L    g++       + ek   +                    N +
  gi|8778463   387 TLLKLNAKQGdtylLETAADTEKWTNI--------------------NAF 416  

                   kvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnL
                   + + V  +  d+       +Lk+ +     h+s+          i M   
  gi|8778463   417 TLKMVMRHVKDT-GAELAKRLKIWV----FHFSN----------IPM--- 448  

                   LqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGI
                                s     P K      ++        +++t+ r++  I
  gi|8778463   449 --------YSSSSSS-SATPQKFDVFLSFR--------GKDTR-RTF--I 478  

                   slDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   s+   e+  e  I  + F+    Lq      + +r +     
  gi|8778463   479 SFLYKELI-EMGI--RTFKDDVELQ------SGRRIASD    508  

gi|9759608|dbj|BAB11396.1|: domain 1 of 1, from 222 to 596: score 50.4, E = 2.7e-15
                   *->rDFddlVGiEaHlekmksLLcLds.kdeVrMVGIwGPaGIGKTTIAR
                                  l+ +   L  + +++e r+V + G +GIGKT  A+
  gi|9759608   222    ------------LKQLAVKLNVECnDNETRIVEVVGMPGIGKTYLAK 256  

                   ALfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGm
                    Lf +L      ++  + +F+e +r++    e gS         e     
  gi|9759608   257 KLFAKLK-----KKINHCVFIEFKREMSA--EQGS---------EW---- 286  

                   KLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQL.
                      LQ+++   +L+ +D    + L v ++ L d+KV I+ DDV d +Q +
  gi|9759608   287 ---LQKRLVEGLLDIQDCTDTNALEVWKDSLIDKKVVIVFDDVSDKKQIs 333  

                   dALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIF
                   + L +   W   GS I++TT Dk L +    ++  YeV    + + L+ F
  gi|9759608   334 EPLKGICDWIKKGSMIVITTRDKSLTEGLVTDL--YEVPGLNERDGLELF 381  

                   ....CrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkske
                   + + C            F+eL +r+++  a   PL+L   G  LRGk++ 
  gi|9759608   382 raqvCCN------IEGNFMEL-SRKFVDFARGNPLALEEFGKELRGKDEA 424  

                   eWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNge
                    We  L  L      + +  I + Lr sYD+L+e+ ++ FL IA fF+ +
  gi|9759608   425 HWETRLGTLAQ----HSNPTIREKLRSSYDELNEQQKDAFLDIAYFFRSQ 470  

                   kvdyVkalL.......adsnnLDVrqGLkvLadKSLIhisplgnedkvdg
                   + +yV +lL++ ++++a+s      q +  LadK LI +         dg
  gi|9759608   471 DESYVRSLLdsydpesAES-----GQEFRDLADKFLIGVC--------DG 507  

                   tieMHnLLqqLGReAIVrk...QsidhdePgKRqFLvDaeeIcdV.Ltdn
                   ++eMH+LL  +++e IV ++ ++s        R  L    e  + +L+ +
  gi|9759608   508 RVEMHDLLFTMAKE-IVEAtaeKS--------RLLLSSCAELKNKeLSLD 548  

                   TGtgtrsVlGIslDtseieeelnIsekAFegMrNLqFLriykksfrddgk
                      +  +V GI lD+se+e e      +F gM+ L++L++y ++   + k
  gi|9759608   549 QQGR-DKVRGIVLDMSEME-EKPLKRAVFVGMSSLRYLKVYSSLCPTHSK 596  

                   <-*
                      
  gi|9759608     -     -    

gi|8843808|dbj|BAA97356.1|: domain 1 of 1, from 176 to 459: score 49.6, E = 3e-15
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      +D + lV ++ H++    LL L+  +eVr +GIwG+aG+GKTT AR 
  gi|8843808   176    NDSNALVAMDRHMKVVYDLLALEVNKEVRTIGIWGSAGVGKTTLARY 222  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    +  ++      +Fq ++F +n+                 +  +    +K
  gi|8843808   223 IYAEIF-----VNFQTHVFLDNVE----------------NMKDKL--LK 249  

                   LhLQeqfLSkIL...nqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQ
                      +e     ++ ++ +++ +I       e R k++K L+i DDV++ eQ
  gi|8843808   250 FEGEED--PTVIissYHDGHEIT------EARRKHRKILLIADDVNNMEQ 291  

                   LdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqI
                    + +   ++WF pGSR+I + ++k LL   g+ + +YeV     +eALq 
  gi|8843808   292 GKWIIEYANWFAPGSRVILISQNKNLLVDAGVMD-VYEVRSLRYDEALQV 340  

                   FCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWe
                   F   AF+Q  Pp +FeeL A++ ++LaG LPLGLr lGS L Gk  eeW+
  gi|8843808   341 FSHFAFKQPYPPSDFEEL-AVRAVHLAGFLPLGLRLLGSFLAGKGREEWV 389  

                   dmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvd
                    +L  L+        g I++v +                       ++  
  gi|8843808   390 AALLKLKA----KQGGHIMEVWKL----------------------ME-- 411  

                   yVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqq
                         a +             dK L   +                    
  gi|8843808   412 ------ATD-------------DKGLEEWE-------------------- 422  

                   LGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslD
                    + + IV +++                       d++  +          
  gi|8843808   423 TAAD-IVERKESS--------------------QDKSQQE---------- 441  

                   tseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                    se+   + I                  k ++ d++   
  gi|8843808   442 -SEVAADILI-----------------GKESSQDKQ    459  

gi|7484921|pir||T06143: domain 2 of 2, from 694 to 1041: score 27.4, E = 4.2e-14
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      +   +l Gi a l   +s        +V + GIwG aGI        
  gi|7484921   694    KSSKNLLGILALLNHSQS-------TDVEIMGIWGIAGI-------- 725  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                               +F+l + m   r                          
  gi|7484921   726 ------------DFHLMCQMKRPR-------------------------- 737  

                   LhLQeqfLSkIL.nqkDikIhd.HLGvieERLkdqKVLIiLDDVDdleQL
                    +L+e f Sk+++  k++  +d     ++++ + +  L++LDDV +    
  gi|7484921   738 -QLREDFISKLFgEEKGLGASDvKPSFMRDWFHKKTILLVLDDVSNARDA 786  

                   dALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIF
                   +A  +   WF +G RII T   kq L +  ++   Ye    S+ e +  +
  gi|7484921   787 EAVIGGFGWFSHGHRIILTSRSKQVLVQCKVKKP-YEIQKLSDFESFR-L 834  

                   CrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWed
                   C      ++  dG +     e +      PL+L+ l Ss         +d
  gi|7484921   835 C------KQYLDGENPV-ISELISCSSGIPLALKLLVSSVSKQYITNMKD 877  

                   mLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdy
                    L  Lr+         I++  r s+DgL+e+++ +FL  ACfF+g+  dy
  gi|7484921   878 HLQSLRK----DPPTQIQEAFRRSFDGLDENEKNIFLDLACFFRGQSKDY 923  

                   VkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqL
                      lL +        G + L d SLI+          d  ieM    q +
  gi|7484921   924 AVLLLDAC-GFFTYMGICELIDESLISLV--------DNKIEMPIPFQDM 964  

                   GReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDt
                   GR  IV+++    ++P +R  L D+++I dVLt+n+Gt+  ++ GI lD 
  gi|7484921   965 GRI-IVHEED---EDPCERSRLWDSKDIVDVLTNNSGTE--AIEGIFLDA 1008 

                   seieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   s + +el+    +F +M NL+ L++y+++++ + k   
  gi|7484921  1009 SDLTCELSP--TVFGKMYNLRLLKFYCSTSGNQCK    1041 

gi|5903074|gb|AAD55632.1|AC008017_5: domain 1 of 1, from 165 to 421: score 25.3, E = 5.5e-14
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         d+lVG++  ++ +  LL+++  +eVr +GIwGP GIGKTT AR 
  gi|5903074   165    AKGDGLVGMDRQMQTLYKLLDFKAAEEVRLIGIWGPGGIGKTTLARY 211  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    +  +S     s+F  ++F+++                ++++ +++    
  gi|5903074   212 AYEEIS-----SNFKVHVFVDKAE--------------KICHQDRD---- 238  

                   LhLQeqfLSkILnqk......DikIhdHLGvieERLkdqKVLIiLDDVDd
                          L k+L  k+++++ D+ I+     i+    ++K LI++D VD+
  gi|5903074   239 -------LLKLLTEKgttqglDVGID----KIKSTFGHRKGLIVIDCVDN 277  

                   leQLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeA
                   ++QL+ ++  ++WF pGSR+I +T+D+ LL   g++h  YeV     +eA
  gi|5903074   278 IKQLKEIVYLAHWFIPGSRVIFVTQDRNLLVESGVEH-AYEVQSLRYDEA 326  

                   LqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkske
                   Lq F  sAF Q  Pp  Fe L + + +++ G LPL L++lGSsLRGk++e
  gi|5903074   327 LQLFSHSAFDQQHPPTSFESL-SLRAVHISGFLPLTLKILGSSLRGKDEE 375  

                   eWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNge
                   +We++L  L+       D++                              
  gi|5903074   376 RWEKELQQLEG------DQE------------------------------ 389  

                   kvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnL
                              +                   i                  
  gi|5903074   390 -----------K------------------AIM----------------- 393  

                   LqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGI
                         e I  k  +                         G +       
  gi|5903074   394 ------E-ITSKRYT-----------------------RAGKK------- 406  

                   slDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                        e ++e                 +i   sf+       
  gi|5903074   407 -----EEDKE-----------------KIT--SFILLSD    421  

gi|7267584|emb|CAB78065.1|: domain 1 of 1, from 203 to 457: score 23.9, E = 6.4e-14
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                          +l+G++ H+ +++ LL+L+s +eVr +GI+G+ G+GKTT AR 
  gi|7267584   203    ----GLIGLDRHMLALNELLDLKSNEEVRLIGICGQGGVGKTTLARY 245  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    +  L+     ++F+ ++F++n  ++y+              De    ++
  gi|7267584   246 VYEELF-----KNFHAHVFVDNAGKIYK-----------QDTDESH--SQ 277  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLk....dqKVLIiLDDVDdle
                    +L  +   +I        +  L v+ +  k++ ++q+ L++ D VD+++
  gi|7267584   278 KSLTSK---EIQEGTQTVTR-TLTVASDFIKstvsHQRSLLVVDCVDNIK 323  

                   QLdALAketq.WFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeAL
                   QL+ +A+    +F pGSR+I +T+Dk+LL  +g++h +YeV     +eAL
  gi|7267584   324 QLEEIANIVGlCF-PGSRVILVTQDKKLLDDFGVEH-VYEVQSLRYDEAL 371  

                   qIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskee
                   q F +sAF Q  Pp  Fe L +++ ++ aG LPL L++lGSsL  k+ ++
  gi|7267584   372 QVFSQSAFNQQHPPASFESL-SFRAVRVAGFLPLLLKILGSSLQDKDGKY 420  

                   WedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgek
                   We++L RL+                                      g++
  gi|7267584   421 WEKELQRLEG-------------------------------------GQE 433  

                   vdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLL
                             +                   i                   
  gi|7267584   434 ----------K------------------AIM------------------ 437  

                   qqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIs
                        e  V k+s                           t+        
  gi|7267584   438 -----E--VMKKSC--------------------------TR-------- 446  

                   lDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                         e                   ++ +   ++  +   
  gi|7267584   447 ------E-------------------KVPTF--IFPLN    457  

gi|9758877|dbj|BAB09431.1|: domain 1 of 1, from 437 to 669: score 12.0, E = 2.7e-13
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      r F+dlVG+   +++++ LL L+s++eVr VGIwG  GIGKTT  R 
  gi|9758877   437    RSFEDLVGMNHRMQALSALLELESDKEVRVVGIWGTGGIGKTTLSRY 483  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    + ++S      +F+ +aF en           S+          s    
  gi|9758877   484 AYERIS-----QQFHTHAFLENAQ--------ESS---------SS---- 507  

                   LhLQeqfLSkILnqkDikIhdH....LGvieERLkdqKVLIiLDDVDdle
                    +L+e+fLSk +  + + ++ ++++    ++   +++KVL+i DDVD+++
  gi|9758877   508 -CLEERFLSKAIQREALAVR-NskdcPEIMKSLIQHRKVLLIVDDVDNVK 555  

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                    L+   k t+W  pGSR+IVT  D  +L a g+++ I eV+    + ALq
  gi|9758877   556 TLEEVFKITSWLVPGSRVIVTARDESFLLASGVKY-IFEVKGLRFDQALQ 604  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    F + AF+Q+sPp  F +L +++ +kL+G LPL+L+V GS L +k++ +W
  gi|9758877   605 LFYQFAFKQKSPPVRFRQL-SVRAIKLVGFLPLALKVTGSMLYRKKESYW 653  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                   e +L  ++                                          
  gi|9758877   654 ETILQCFEE----------------------------------------- 662  

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                                                                     
  gi|9758877     - -------------------------------------------------- -    

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                      ++                               n+Gt          
  gi|9758877   663 ---KQ-------------------------------NKGTI--------- 669  

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                           
  gi|9758877     - -------------------------------------    -    

gi|9858478|gb|AAG01052.1|AF175395_1: domain 1 of 1, from 185 to 435: score 9.9, E = 3.4e-13
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         d lVG++    + ksLL+   +d V MVGI G  G+GKTT A A
  gi|9858478   185    --SDVLVGLKSPVLAVKSLLDVGADDVVHMVGIHGLGGVGKTTLAVA 229  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++ +        F+  +F en+r           et+++   e      
  gi|9858478   230 VYNSIA-----CHFEACCFLENVR-----------ETSNKKGLE------ 257  

                   LhLQeqfLSkILnqkDikIhdHLG....vieERLkdqKVLIiLDDVDdle
                    +LQ+ +LSk  +   i++  +  ++++ i+  Lk +KVL++LDDV+  e
  gi|9858478   258 -SLQNILLSKTVGDMKIEVT-NSRegtdIIKRKLKEKKVLLVLDDVNEHE 305  

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   QL A+ +   WFG GSR+I+TT D qLL  H+++ t Y+V    +++ALq
  gi|9858478   306 QLQAIIDSPDWFGRGSRVIITTRDEQLLVLHNVKRT-YKVRELNEKHALQ 354  

                   IFCrsAFg.QnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskee
                    + + AFg ++     + ++  ++ ++ a  LPL+L+V GS+L Gks ee
  gi|9858478   355 LLTQKAFGlEKKVDPSYHDI-LNRAVTYASGLPLALKVIGSNLFGKSIEE 403  

                   WedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgek
                   We +L   +     s D  I  +L+vsYD+L+e +               
  gi|9858478   404 WESVLDGYER----SPDKSIYMTLKVSYDALNEDE--------------- 434  

                   vdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLL
                                                                     
  gi|9858478     - -------------------------------------------------- -    

                   qqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIs
                                                            +        
  gi|9858478   435 -----------------------------------------K-------- 435  

                   lDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                            
  gi|9858478     - --------------------------------------    -    

gi|9858476|gb|AAG01051.1|AF175394_1: domain 1 of 1, from 183 to 438: score -3.4, E = 1.7e-12
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         d lVG+E    + ksLL+   +d V MVGI G aG+GKTT A A
  gi|9858476   183    HVSDVLVGLESPVLEVKSLLDVGRDDVVHMVGIHGLAGVGKTTLAIA 229  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++ +        F+ s+F en++          + + +++  e      
  gi|9858476   230 VYNSIA-----GHFEASCFLENVK----------RTSNTINGLE------ 258  

                   LhLQeqfLSkILnqkDikIhdHLG....vieERLkdqKVLIiLDDVDdle
                     LQ  +LSk  +   ik   +  ++ + i+  Lk++KVL+iLDDVD  +
  gi|9858476   259 -KLQSFLLSKTAGE--IKLT-NWRegipIIKRKLKQKKVLLILDDVDEDK 304  

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   QL AL +   WFG GSRII+TT D +LL  H+++ t Y+V    +++ALq
  gi|9858476   305 QLQALIGSPDWFGLGSRIIITTRDEHLLALHNVKIT-YKVRELNEKHALQ 353  

                   IFCrsAFg.QnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskee
                    + + AF  ++     + ++  ++ ++ a  LP  L V GS+L Gks ee
  gi|9858476   354 LLTQKAFElEKGIDPSYHDI-LNRAVTYASGLPFVLEVIGSNLFGKSIEE 402  

                   WedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgek
                   W+ +L   +       + k   +L+vsYD+L+e ++++FL          
  gi|9858476   403 WKSALDGYER----IPHKKNLCILKVSYDALNEDEKSIFL---------- 438  

                   vdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLL
                                                                     
  gi|9858476     - -------------------------------------------------- -    

                   qqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIs
                                                                     
  gi|9858476     - -------------------------------------------------- -    

                   lDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                            
  gi|9858476     - --------------------------------------    -    

gi|7484914|pir||T06146: domain 1 of 1, from 200 to 602: score -19.8, E = 1.2e-11
                   *->rDFddlVGiEaHlekmksLLcL..dskdeVrMVGIwGPaGIGKTTIA
                         d + G+   l++++     ++d  de r+V + G +GIGK+T  
  gi|7484914   200    AKADKISGLNQRLKELEEKVAItgDKRDETRIVEVVGMPGIGKSTLL 246  

                   RALfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyG
                   +A +  +       +F  sa   n++++ +           a+       
  gi|7484914   247 KAFYETWK-----TRFLSSALLQNISELVK-----------AMGLG---- 276  

                   mKLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDd....
                      +L  ++L ++L  ++i  +      +E L    V+I+LD++ d+++ 
  gi|7484914   277 ---RLTGMLLKELLPDENIDEE-TYEPYKEKLLKNTVFIVLDGISDethi 322  

                   leQLdALAketqWFGpGSRIIV....TTeDkqLLkaHg.InhtIYeVgfP
                   +++L+   +  +W   GS I++ ++ +T  + LL     + +t Y V + 
  gi|7484914   323 QKLLK---DHRKWAKKGSKIVIarraVT--RDLLHEDSmVRYT-YFVPLL 366  

                   SkeeALqIFCrsAFgQnsPp....dGFeeLeAreVtkLaGnLPLGLrVlG
                   S  + L  FC +AF++  +++++++ F++  ++e+++ a   PL L+ lG
  gi|7484914   367 SHRDGLNHFCHYAFRHFAAHqnnkEAFMKE-SKEFVRYARGHPLILKLLG 415  

                   SsLRGkskeeWedmLpRLrtsfgnsLDgkIek.vLrvsYDgLhekDqaLF
                     LR ks  +We+ L  L +    sL ++I ++vL+v YD+L++  ++ F
  gi|7484914   416 EELREKSLSYWEEKLKSLPK----SLSQNIRDrVLQVTYDELSQVQKDAF 461  

                   LhIACfFNgekvdyVkalLadsn..nLDVrqGLkvLadKSLIhisplgne
                   L IACf  +    yVk+lL  s++ +   ++    L d   I is     
  gi|7484914   462 LDIACFRSHDL-VYVKSLLDSSGpaFSKATVTIDALKDMFMIYIS----- 505  

                   dkvdgtieMHnLL....qqLGReAIVrkQsidhdePgKRqFLv....Dae
                      d ++eMH+LL +   +LG eA  r         g +++  ++++D +
  gi|7484914   506 ---DSRVEMHDLLytfaMELGPEA--RDDD----GRGRHRIWHhhnqDNK 546  

                   eIcdVLtdnTGtgtrsVlGIslDtseieeelnIsekAFegMrNLqFLriy
                      + L    G +t sV    lD++ ++  +    + ++ MrNL++L++y
  gi|7484914   547 GRLNRLLKRPGGST-SVRSFFLDMYVMKTDVTLGTDYLKNMRNLRYLKFY 595  

                   kksfrddgk<-*
                    +   + ++   
  gi|7484914   596 SS--HCPQE    602  

gi|5903076|gb|AAD55634.1|AC008017_7: domain 1 of 1, from 247 to 507: score -25.8, E = 2.4e-11
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                       D ++lVG+  H ++   LL+L+sk++Vr +GIwG  G+GKTT A  
  gi|5903076   247    DDSNGLVGMYRHKKAVYGLLDLESKNQVRTIGIWGFQGVGKTTLAEC 293  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    f+ +S     s Fq+ +F +n  ++y        ++r++     s  + 
  gi|5903076   294 VFDDIS-----SHFQHYCFLTNANKIY--------QNRIS----PS--LL 324  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVD...dleQ
                    hL ++  S+         +  + +i+  L ++KVL + D+VD + + ++
  gi|5903076   325 KHLTRRRSSE---------D-IFDAIKPSLVNRKVLFVVDGVDatyNEQF 364  

                   LdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqI
                    dA+ k t+W GpGSRII T   k  Lk +g     Ye +    eeALq 
  gi|5903076   365 NDAM-KVTRWLGPGSRIIMTSRFKSSLK-FGGAK--YEMECLRYEEALQL 410  

                   FCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWe
                   F ++AF+++ P  GFe   + + ++ aG LPL L+VlGS L  k++e W+
  gi|5903076   411 FSLYAFKKTYPLIGFELF-SIRAVHFAGRLPLSLKVLGSFLYDKDEESWK 459  

                   dmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvd
                   ++L+ L+     s D +                               + 
  gi|5903076   460 RTLHKLEA----SQDND-------------------------------RR 474  

                   yVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqq
                   yV  ++++          + L        +                    
  gi|5903076   475 YVSNYIGAG---------EYLP-------R-------------------- 488  

                   LGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslD
                     R+ I                                 +          
  gi|5903076   489 --RQ-I---------------------------------E---------- 492  

                   tseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                      +e                q+ + ++    +++    
  gi|5903076   493 ---LE----------------QYVSPDEE--EYSPS    507  

gi|4100321|gb|AAD00827.1|: domain 1 of 1, from 1 to 209: score -28.7, E = 3.4e-11
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                             G+                 +V           GKTT A A
  gi|4100321     1    -------GM----------------GGV-----------GKTTLASA 13   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    +  ++     ++F+ ++   n+r+          e+ ++gl        
  gi|4100321    14 AYAEIY-----HRFEGHCLLQNIRE----------ESNKHGLEK------ 42   

                   LhLQeqfLSkILnqk...DikIhdHLGvieERLkdqKVLIiLDDVDdleQ
                     LQe+fLS +L+ + + + +I+     ie RL++++VL++LDDVDdl+Q
  gi|4100321    43 --LQEKFLSLVLKADvkvGSEIE-GRSIIERRLRNKRVLVVLDDVDDLKQ 89   

                   LdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqI
                   L+ALA+   WFG GSRII+TT D +LL  H  +  IYeV++ S +eA + 
  gi|4100321    90 LEALAGSHAWFGKGSRIIITTRDEHLLTCHA-DA-IYEVSLLSHDEAIEL 137  

                   FCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWe
                   F  +A++++ P +++e+L ++ V+  a  LPL+L +lGS L  k+k+eW+
  gi|4100321   138 FNKHAYRKDKPIEDYEML-SKDVVSYASGLPLALEILGSFLYDKDKDEWK 186  

                   dmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvd
                    +L  L+                                           
  gi|4100321   187 SALAKLKD------------------------------------------ 194  

                   yVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqq
                                               i                     
  gi|4100321   195 ----------------------------IP-------------------- 196  

                   LGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslD
                                                     +++ t+          
  gi|4100321   197 ----------------------------------NDKVTR---------- 202  

                   tseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                          L+i  +          
  gi|4100321   203 ----R------------------LKISYD-------    209  

gi|3176745|gb|AAC50026.1|: domain 1 of 1, from 1 to 146: score -53.5, E = 6.5e-10
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                +V           GKTTIARA
  gi|3176745     1    -------------------------GGV-----------GKTTIARA 11   

                   LfsqLSerhFqssFqlsaFmenlrgsysk....eeigSg..etrpaglDe
                   L +q+S     ++Fql+aF++ +r +y ++  +e   Sg + +   + D+
  gi|3176745    12 LRDQIS-----ENFQLTAFIDDIRLTYPRrcygE---SGlkPPTAFMNDD 53   

                   YsyGmKLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDd
                   +    K  LQ +fLS+ILnqkDi Ih +L +++++Lkd+KVL+iLDDVD+
  gi|3176745    54 R---RKIVLQTNFLSEILNQKDIVIH-NLNAAPNWLKDRKVLVILDDVDH 99   

                   leQLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeA
                   leQLdA+Aket WFG+GSRII+TT+D++LLkaH+I++ IYeVg       
  gi|3176745   100 LEQLDAMAKETGWFGYGSRIIITTQDRKLLKAHNIDY-IYEVG------- 141  

                   LqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkske
                                       L            PL+L             
  gi|3176745   142 --------------------L------------PLAL------------- 146  

                   eWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNge
                                                                     
  gi|3176745     - -------------------------------------------------- -    

                   kvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnL
                                                                     
  gi|3176745     - -------------------------------------------------- -    

                   LqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGI
                                                                     
  gi|3176745     - -------------------------------------------------- -    

                   slDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                             
  gi|3176745     - ---------------------------------------    -    

gi|13310478|gb|AAK18307.1|AF338975_1: domain 1 of 1, from 1 to 129: score -54.3, E = 7.1e-10
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                                     
  gi|1331047     -    ----------------------------------------------- -    

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                                      m+n++++y          r ++lD+Y+  +K
  gi|1331047     1 -------------------MGNIKETY----------RRINLDDYG--SK 19   

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   Lh Qe+ LSk++n+kDikI+ HLGv++ERLkd++VL++LDDVD+leQL A
  gi|1331047    20 LHMQEECLSKLINHKDIKIP-HLGVVRERLKDKRVLVVLDDVDKLEQLIA 68   

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   LAke +WFGpGSRI+VTT+D+qLLkaHgI++ +Y+V++PS+ eAL+IFC+
  gi|1331047    69 LAKEPRWFGPGSRIVVTTQDRQLLKAHGIDL-VYKVELPSRTEALEIFCQ 117  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   sAFgQ+ Pp                                         
  gi|1331047   118 SAFGQKHPP------C---------------------------------- 127  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                                                                     
  gi|1331047     - -------------------------------------------------- -    

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                                                                     
  gi|1331047     - -------------------------------------------------- -    

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtse
                     +                                 g             
  gi|1331047   128 --V---------------------------------G------------- 129  

                   ieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                       
  gi|1331047     - ---------------------------------    -    

gi|13310476|gb|AAK18306.1|AF338974_1: domain 1 of 1, from 1 to 129: score -55.5, E = 8.1e-10
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                                     
  gi|1331047     -    ----------------------------------------------- -    

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                                      m+n++++y          r ++lD+Y+  +K
  gi|1331047     1 -------------------MGNIKETY----------RRISLDDYG--SK 19   

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   LhLQe+fLSk++n+kD+kI+ H Gv++ERLkd++V+++LDDVD leQL A
  gi|1331047    20 LHLQEEFLSKLINHKDVKIP-HSGVVRERLKDKRVFVVLDDVDELEQLIA 68   

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   LAke +WFG+GSRI+VTT+D+qLLkaHgI++ +Y+V++PS+ eAL+IFC+
  gi|1331047    69 LAKEPRWFGSGSRIVVTTQDRQLLKAHGIDL-VYKVELPSRLEALEIFCQ 117  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   sAFgQ+ Pp                                         
  gi|1331047   118 SAFGQKHPP------C---------------------------------- 127  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                                                                     
  gi|1331047     - -------------------------------------------------- -    

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                                                                     
  gi|1331047     - -------------------------------------------------- -    

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtse
                     +                                 g             
  gi|1331047   128 --V---------------------------------G------------- 129  

                   ieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                       
  gi|1331047     - ---------------------------------    -    

gi|13310457|gb|AAK18297.1|AF338964_1: domain 1 of 1, from 1 to 129: score -62.4, E = 1.9e-09
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                                     
  gi|1331045     -    ----------------------------------------------- -    

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                                      m+n++++y          r ++lD+Y+  +K
  gi|1331045     1 -------------------MGNIKETY----------RRINLDDYG--SK 19   

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   Lh Qe+ LSk++n+kDikI+ HLGv++ERLkd++VL++LDDVD+leQL A
  gi|1331045    20 LHMQEECLSKLINHKDIKIP-HLGVVRERLKDKRVLVVLDDVDKLEQLIA 68   

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   LAke +WFGpGSRI+VTT+D+q LkaHgI++ +Y+V++PS+ eAL+IFC+
  gi|1331045    69 LAKEPRWFGPGSRIVVTTQDRQPLKAHGIDL-VYKVELPSRTEALEIFCQ 117  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   sAFgQ+ Pp                                         
  gi|1331045   118 SAFGQKHPP------C---------------------------------- 127  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                                                                     
  gi|1331045     - -------------------------------------------------- -    

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                                                                     
  gi|1331045     - -------------------------------------------------- -    

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtse
                     +                                 g             
  gi|1331045   128 --V---------------------------------G------------- 129  

                   ieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                       
  gi|1331045     - ---------------------------------    -    

gi|11761674|gb|AAG40138.1|AF209493_1: domain 1 of 1, from 1 to 171: score -68.2, E = 3.7e-09
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                +V           GKTTIA+ 
  gi|1176167     1    -------------------------GGV-----------GKTTIAKH 11   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L++ LS     s+Fq ++Fmen++                ++ ++ yG+ 
  gi|1176167    12 LYNELS-----SRFQAHCFMENVK----------------EVSNR-YGVR 39   

                   LhLQeqfLSkILnqkDik....IhdHLGvieERLkdqKVLIiLDDVDdle
                    +LQ +fL  +++  D +  ++++     i+ER ++++VLI+LDDVD +e
  gi|1176167    40 -RLQGEFLCRMFGERDKEawssVS-CSSMIKERFRHRRVLIVLDDVDRSE 87   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   QL  L+ket WFGpGSRI+VTT D++LL +HgI++ IY+V+   k+eALq
  gi|1176167    88 QLNELVKETGWFGPGSRIVVTTRDRHLLVSHGIDL-IYKVKCLHKKEALQ 136  

                   IFCrsAFg.QnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskee
                    FC +AF++++  p+ F +L +++ ++ a  +PL+L              
  gi|1176167   137 LFCNYAFRnEMIVPHEFLKL-SVQAINYASGFPLAL-------------- 171  

                   WedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgek
                                                                     
  gi|1176167     - -------------------------------------------------- -    

                   vdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLL
                                                                     
  gi|1176167     - -------------------------------------------------- -    

                   qqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIs
                                                                     
  gi|1176167     - -------------------------------------------------- -    

                   lDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                            
  gi|1176167     - --------------------------------------    -    

gi|11761672|gb|AAG40137.1|AF209492_1: domain 1 of 1, from 1 to 165: score -69.4, E = 4.3e-09
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                +V           GKTTIA+ 
  gi|1176167     1    -------------------------GGV-----------GKTTIAKY 11   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L+++LS     s+Fq ++Fmen+++     + ++         e      
  gi|1176167    12 LYNKLS-----SRFQAHCFMENVKEVC---NRYG--------VE------ 39   

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                    +LQ +fL  +++  D   +     i+ER + ++VLI+LDDVD +eQ d 
  gi|1176167    40 -RLQGEFLCRMFRERDSVSC--SSMIKERFRRKRVLIVLDDVDRSEQVDG 86   

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   L ket WFGpGSRIIVTT D++LL +HgI++ IY+V+   ++eAL  FC 
  gi|1176167    87 LFKETGWFGPGSRIIVTTRDRHLLVSHGIEL-IYKVKCLPEKEALHLFCN 135  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   +AF+  +    F  L A++ ++ a  LPL+L                   
  gi|1176167   136 YAFRNETIAPEFRVL-AVQAVNYASGLPLAL------------------- 165  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                                                                     
  gi|1176167     - -------------------------------------------------- -    

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                                                                     
  gi|1176167     - -------------------------------------------------- -    

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtse
                                                                     
  gi|1176167     - -------------------------------------------------- -    

                   ieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                       
  gi|1176167     - ---------------------------------    -    

gi|7484488|pir||T08068: domain 1 of 1, from 1 to 264: score -72.7, E = 6.3e-09
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                   M                 
  gi|7484488     1    -----------------------------M----------------- 1    

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                        S           +F + +r                +    s  ++
  gi|7484488     2 -----S-----------CFLSDVR---------------ENAGKTS--LQ 18   

                   LhLQeqfLSkILnqkDikIhdHLG....vieERLkdqKVLIiLDDVDdle
                    +LQ+++L  ++   D kI+    ++ + ++  L     L+iLDDVD++ 
  gi|7484488    19 -SLQNKLLNSLIQL-DEKIE-SVSegikLLKTHLSSCEALVILDDVDHVN 65   

                   QLdALAketqW.FGpGSRIIVTTeDkqLLkaHgInht.IYeVgfPSkeeA
                   QLdAL   ++    p S I +T  Dk  L   +++  +IY+    S++  
  gi|7484488    66 QLDALLRPIRTvLHPRSLILITSRDKDVLTRSRVEESsIYKLTGLSTQQS 115  

                   LqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkske
                    + FCr+AF Q  P  GFe+L ++++ k +  LPL L+V G    G +k 
  gi|7484488   116 QELFCRHAFTQGHPLPGFEDL-VEKFLKACYGLPLSLKVFGALVYGNDKS 164  

                   eWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNge
                    Wed+L RL+      L ++I+k L++sY +L   ++ +FL +ACfF ge
  gi|7484488   165 FWEDQLDRLEQ----ILPDEIQKRLQISYYALQMDEKQIFLDVACFFIGE 210  

                   kvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnL
                   k+d+       s     ++G+++L +KSL+ ++++++       i+MH+ 
  gi|7484488   211 KRDTAIRIWDGS-GWKGSLGFQILQNKSLVEVDTENE-------IRMHHH 252  

                   LqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGI
                   L+ +GR+                            L+++           
  gi|7484488   253 LRDMGRD----------------------------LANDA---------- 264  

                   slDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                             
  gi|7484488     - ---------------------------------------    -    

gi|6648975|gb|AAF21316.1|: domain 1 of 1, from 1 to 204: score -102.7, E = 2.2e-07
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                             +  +V           GKTTIA+A
  gi|6648975     1    -----------------------N-GGV-----------GKTTIAKA 12   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   +f+ LS      +F   +F   ++++           r+++l+       
  gi|6648975    13 MFDTLS-----YQFKAACFLADVKENS----------RKNELH------- 40   

                   LhLQeqfLSkILnqkDikIhdHLG...vieERLkdqKVLIiLDDVDdleQ
                    +LQ+ +LS++L++kD  I++ L ++  i+ RL+ + VLI+L    + + 
  gi|6648975    41 -SLQNTLLSELLRKKDNYINNKLDgkcLIPSRLCSMNVLIVL----HNDH 85   

                   LdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqI
                   L+ LA++  WFG GSR++VTT +++L +    ++ IYeV    + eA+q 
  gi|6648975    86 LEYLAGDLCWFGIGSRVVVTTRNRHLIEK---DDAIYEVPALPDPEAMQL 132  

                   FCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWe
                     ++A ++    + F++  + eV+++a  LPL+L+V GS L++++  eW 
  gi|6648975   133 CNQHALKKEISDECFKMF-SLEVVNIAKGLPLALKVWGSFLHRRDITEWR 181  

                   dmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvd
                   +++   +       + +I   L++sYD                       
  gi|6648975   182 NAIEQMKY----NSNSEIIQKLKISYD----------------------- 204  

                   yVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqq
                                                                     
  gi|6648975     - -------------------------------------------------- -    

                   LGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslD
                                                                     
  gi|6648975     - -------------------------------------------------- -    

                   tseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                          
  gi|6648975     - ------------------------------------    -    

gi|6648973|gb|AAF21315.1|: domain 1 of 1, from 1 to 205: score -103.9, E = 2.6e-07
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                             G+                 +V           GKTTIA+A
  gi|6648973     1    -------GM----------------GGV-----------GKTTIAKA 13   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   +f+ LS      +F   +F   ++++           r+++l+       
  gi|6648973    14 MFDTLS-----YQFKAACFLADVKENS----------RKNELH------- 41   

                   LhLQeqfLSkILnqkDikIhdHLG...vieERLkdqKVLIiLDDVDdleQ
                    +LQ+ +LS++L++kD  I++ L ++  i+ RL+ + VLI+L    + + 
  gi|6648973    42 -SLQNTLLSELLRKKDNYINNKLDgkcLIPSRLCSMNVLIVL----HNDH 86   

                   LdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqI
                   L+ LA++  WFG GSR++VTT +++L +    ++ IYeV    + eA+q 
  gi|6648973    87 LEYLAGDLCWFGIGSRVVVTTRNRHLIEK---DDAIYEVPALPDPEAMQL 133  

                   FCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWe
                     ++A ++    + F++  + eV+++a  LPL+L+V GS L++++  eW 
  gi|6648973   134 CNQHALKKEISDECFKMF-SLEVVNIAKGLPLALKVWGSFLHRRDITEWR 182  

                   dmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvd
                   +++   +       + +I   L++sYD                       
  gi|6648973   183 NAIEQMKY----NSNSEIIQKLKISYD----------------------- 205  

                   yVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqq
                                                                     
  gi|6648973     - -------------------------------------------------- -    

                   LGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslD
                                                                     
  gi|6648973     - -------------------------------------------------- -    

                   tseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                          
  gi|6648973     - ------------------------------------    -    

gi|6648977|gb|AAF21317.1|AF121437_1: domain 1 of 1, from 1 to 209: score -108.1, E = 4.3e-07
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                             G+                 +V           GKTTIA+ 
  gi|6648977     1    -------GM----------------GGV-----------GKTTIAKT 13   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                       LS      +F + +F    + + +                ++    
  gi|6648977    14 ILEILS-----YQFKDACFLADAKQNAK----------------RN--QP 40   

                   LhLQeqfLSkILnqkDikIhdHLG...vieERLkdqKVLIiLDDVDdleQ
                     LQ+ +LS++L+ kD   ++ L ++  i  RL+ +KVLI+LDD+D+++ 
  gi|6648977    41 HLLQNILLSELLRNKDDYLNNKLDgkcMISTRLCSMKVLIVLDDIDHSDH 90   

                   LdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqI
                   L+ LA +  WFG GSR+++TT ++qL +    ++ +YeV+   ++eA+  
  gi|6648977    91 LEYLAADCCWFGDGSRVVITTRNRQLIEN---DDSVYEVSTLPDDEAMLL 137  

                   FCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWe
                   F ++A +++ P + ++   + +V+++a  LPL+L+V GS ++ k+   W 
  gi|6648977   138 FNQHALKKKIPDECCKSF-SLKVVNHAKGLPLALKVWGSLFHWKDLTQWR 186  

                   dmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvd
                                                                 ++vd
  gi|6648977   187 ----------------------------------------------RIVD 190  

                   yVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqq
                   ++k   ++s                                         
  gi|6648977   191 KIK---EKS----------------------------------------- 196  

                   LGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslD
                                                                     
  gi|6648977     - -------------------------------------------------- -    

                   tseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   tsei e+                L+i  +          
  gi|6648977   197 TSEIVEK----------------LKISYD-------    209  

gi|5903078|gb|AAD55636.1|AC008017_9: domain 1 of 1, from 208 to 414: score -110.1, E = 5.4e-07
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      r  + l+Gi+ H+ ++  L  L+s ++V  +GIwG    G +  A  
  gi|5903078   208    RNDNILIGIDQHMGELYPLFNLNSNEDVQVIGIWGRGSNGRSALASH 254  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    +  +      + F+ ++F e +r               ++l+ ++    
  gi|5903078   255 VYQNIK-----HHFEAHCFLEDVR--------------RISLHFRD---- 281  

                   LhLQeqfLSkI....LnqkDikIhdHLGvieERLkdqKVLIiLDDVDdle
                    hLQ ++LS +++++L  k+   +  L +i+ RL+++KVL++  DVD+le
  gi|5903078   282 SHLQDELLSNMqgegLTTKNCHRC--LKTIKARLRNKKVLLVANDVDKLE 329  

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   Q dALA e +WFGpGSRII+TT+D+qLL +  +   +YeV+         
  gi|5903078   330 QFDALAEEFSWFGPGSRIIITTQDRQLLISSVVRS-VYEVK--------- 369  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    +  +A +         eL                               
  gi|5903078   370 LLRCYAVR---------EL------------------------------- 379  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                         +r+      +                            F +++ 
  gi|5903078   380 ------FRS------NA---------------------------FKERE- 389  

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                           d+                     p                  
  gi|5903078   390 -------RDD---------------------P------------------ 393  

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                    +G +     Qs                         T            
  gi|5903078   394 -VGFD-----QS-------------------------TYRA--------- 403  

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                    ++ i+ e+n                        ++    
  gi|5903078   404 -MY-IS-EVNL-----------------------EKG    414  

gi|7488668|pir||T08833: domain 1 of 1, from 1 to 170: score -114.3, E = 8.9e-07
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                +V           GKTT A+A
  gi|7488668     1    -------------------------GGV-----------GKTTSAKA 11   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    +sq++     ++F ++ F+e +r         S     ++  +      
  gi|7488668    12 IYSQIH-----RRFMDKSFIESIR---------S-----VCETDSK--GH 40   

                   LhLQeqfLSkILnqkDikIhdHLGv....ieERLkdqKVLIiLDDVDdle
                    hLQeq+LS +Ln k +k+h   G +++ ie RL  ++VLI+LDDV+ + 
  gi|7488668    41 VHLQEQLLSDVLNTK-VKVH-SIGMgttiIEKRLSGKRVLIVLDDVNEIG 88   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   QL+ L +  +WFG GS II+TT D  LL  + +++ +Y+ +   + e L+
  gi|7488668    89 QLENLCGNCEWFGQGSVIIITTRDVGLLNLFKVDY-VYKMEEMDENESLE 137  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    FC++AFg+  P+++F+eL Ar V+  +G LPL                 
  gi|7488668   138 LFCLHAFGEPNPREDFNEL-ARNVVAYCGGLPL----------------- 169  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                                                                     
  gi|7488668     - -------------------------------------------------- -    

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                                                                     
  gi|7488668     - -------------------------------------------------- -    

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                        A                                            
  gi|7488668   170 -----A-------------------------------------------- 170  

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                           
  gi|7488668     - -------------------------------------    -    

gi|5903084|gb|AAD55642.1|AC008017_15: domain 1 of 1, from 181 to 378: score -114.3, E = 8.9e-07
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                          dl Gi+aH++++  LL L+sk+ Vr +GIw   G G +  A++
  gi|5903084   181    SNGSDLEGIDAHMKALHRLLNLNSKKSVRVIGIWARGGNGRSALAKF 227  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    +  +        F+ ++F e ++               ++ D +     
  gi|5903084   228 VYQNIC-----QHFESHCFLESVK--------------RISQDRHL---- 254  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                    hL+e+f+  I +      +  L     RLk+qKVL++ DDV++leQLdA
  gi|5903084   255 SHLHEEFMIRIQGEC---LS-KL-----RLKNQKVLLVADDVNKLEQLDA 295  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   LA + ++FGpGS +I+TT+D+qLL + gI++ +YeV+             
  gi|5903084   296 LAEDFNCFGPGSIVIITTQDRQLLISAGIKL-VYEVE------------- 331  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                                 L                                   
  gi|5903084   332 --------------L----------------------------------- 332  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                                     Lr+      +k   LF+  A  F +++     
  gi|5903084   333 ------------------LRF------QKVRGLFRQLA--FKEKD----- 351  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                                            is                       
  gi|5903084   352 -------------------------IS----------------------- 353  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtse
                    A                                           +++s 
  gi|5903084   354 -A----------------------------------A--------FEVSL 360  

                   ieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                        n+   A e        +  +   ++      
  gi|5903084   361 YR-ATNV---AME--------WLGC---ICGRS    378  

gi|2852684|gb|AAC02202.1|: domain 1 of 1, from 161 to 538: score -116.4, E = 1.1e-06
                   *->rDFddlVG.iEaHlekmksLLcLdskde.....VrMVGIwGPaGIGK
                       D  ++ G+ ++  + ++ LL  d  de+++++  +V I G  G+GK
  gi|2852684   161    VDESGIFGrVDDKNKLLEKLLG-DR-DEsgsqnFSIVPIVGMGGVGK 205  

                   TTIARALfs..qLSerhFqssFqlsaFmenlrgsyskeeigSgetrpagl
                   TT AR L+++++       + F+l+a +  ++                ++
  gi|2852684   206 TTLARLLYDekKVK-----DHFELRAWVC-VS---------------DEF 234  

                   DeYsyGmKLhLQeqfLSkILnq.........kDikIhdHLGvieERLkdq
                      +            S ++ q+ ++++++ +D+   +   +++E L++q
  gi|2852684   235 SVPN-----------ISRVIYQsvtgekkefEDLNLLQ--EALKEKLRNQ 271  

                   KVLIiLDDV.....DdleQLdA..LAketqWFGpGSRIIVTTeDkqLLka
                     LI+LDDV +++  d e L  + LA+      pGSRII TT   qLL+ 
  gi|2852684   272 LFLIVLDDVwsesyGDWEKLVGpfLAG-----SPGSRIIMTTRKEQLLRK 316  

                   HgInhtIYeVgfP....SkeeALqIFCrsAFgQ.......nsPpdGFeeL
                    g  h+    + P ++ S+++AL  F ++AFg ++ +++++  p+G  +L
  gi|2852684   317 LGFSHQ----D-PleglSQDDALSLFAQHAFGVpnfdshpTLRPHG--DL 359  

                   eAreVtkLaGnLPLGLrVlGSsLR.GkskeeWedmLp....RLrtsfgns
                       ++k ++ LPL+Lr lG  LR+  ++e W+++L ++  RL +     
  gi|2852684   360 ----FVKKCDGLPLALRTLGRLLRtKTDEEQWKELLDseiwRLGN----- 400  

                   LDgkIekvLrvsYDgLhekDqaLFLhIACfFN.ge..kvdyVkalLadsn
                     ++I   Lr sY++L+   + LF +   f  ++e +k +++  + a+  
  gi|2852684   401 -GDEIVPALRLSYNDLSASLKLLFAYCSLFPKdYEfdKEELILLWMAEG- 448  

                   nLD........VrqGLkv...LadKSLIhisplgnedkvdgtieMHnLLq
                   +L ++++++++ r+GL+  ++L  +S  +  p++     +   +MH+L  
  gi|2852684   449 FLHqpttnkskQRLGLEYfeeLLSRSFFQHAPNN-----KSLFVMHDLMN 493  

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                    L+    V  + +                          ++        l
  gi|2852684   494 DLATF--VAGEFF--------------------------SR--------L 507  

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   D+  +++e+ +   A+e+ r   F    + +f+ ++k   
  gi|2852684   508 DIE-MKKEFRM--QALEKHRHMSFV---CETFMGHKK    538  

gi|7107244|gb|AAF36336.1|AF186628_1: domain 1 of 1, from 1 to 170: score -116.7, E = 1.2e-06
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                           G+GKTTIARA
  gi|7107244     1    -------------------------------------GVGKTTIARA 10   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L++ +      ++F+ + F++ +r+              ++   ++    
  gi|7107244    11 LYNSIA-----NQFEVTSFISDIRE--------------SSTQHHG---L 38   

                   LhLQeqfLSkILnqkDikIhdHLG....vieERLkdqKVLIiLDDVDdle
                    +LQe +L +  + k+ k   +  ++ + i+ RL+ +KVL+iLDDVD+le
  gi|7107244    39 VQLQESLLYETVGDKNTKLG-NVNkgipIIKKRLCCKKVLLILDDVDKLE 87   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   QL+ALA+   WFG+GS II+TT DkqLL +H ++ t YeV+    eeA++
  gi|7107244    88 QLEALAGGRDWFGSGSKIIITTRDKQLLASHQVDKT-YEVKKLNHEEAFE 136  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    F   AF+ +    G++e+ ++ V+  a  LPL+L               
  gi|7107244   137 LFTWNAFKSKALIGGYMEI-SNNVVSYAEGLPLAL--------------- 170  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                                                                     
  gi|7107244     - -------------------------------------------------- -    

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                                                                     
  gi|7107244     - -------------------------------------------------- -    

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                                                                     
  gi|7107244     - -------------------------------------------------- -    

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                           
  gi|7107244     - -------------------------------------    -    

gi|7107236|gb|AAF36332.1|AF186624_1: domain 1 of 1, from 1 to 170: score -118.0, E = 1.4e-06
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                           G+GKTTIA+A
  gi|7107236     1    -------------------------------------GVGKTTIAKA 10   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++ +      ++F+ + F  n+r                ++ e +   K
  gi|7107236    11 IYNEIG-----RDFECRSFLANVR----------------EVWEKN-AGK 38   

                   LhLQeqfLSkILnqkDikIhdHLG....vieERLkdqKVLIiLDDVDdle
                    hLQeq+L   L+    kI     +++ ++++RL++++VLI+LDDVD le
  gi|7107236    39 VHLQEQLLFDTLKGTTTKIQ-SIDsgkiTLKDRLCHKRVLIVLDDVDELE 87   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIY...eVgfPSkee
                   QLdAL +  +WFG+GSRII+TT D ++L+  +++  +Y+ +e +   ++e
  gi|7107236    88 QLDALCGSRKWFGSGSRIIITTRDMHILRGNRVDT-VYsmkEMD---EDE 133  

                   ALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGksk
                     + F  +AF+Q sP++ F  + +r V+   G LPL+L            
  gi|7107236   134 SVELFSWHAFKQASPREEFVGI-SRNVVMYSGGLPLAL------------ 170  

                   eeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNg
                                                                     
  gi|7107236     - -------------------------------------------------- -    

                   ekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHn
                                                                     
  gi|7107236     - -------------------------------------------------- -    

                   LLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlG
                                                                     
  gi|7107236     - -------------------------------------------------- -    

                   IslDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                              
  gi|7107236     - ----------------------------------------    -    

gi|13937090|gb|AAK50044.1|AF363799_1: domain 1 of 1, from 1 to 171: score -118.8, E = 1.5e-06
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                +V           GKTT  +A
  gi|1393709     1    -------------------------GGV-----------GKTTLVKA 11   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L++ ++     + F+ s+F +n+r+           +  +   e      
  gi|1393709    12 LYDSIY-----KEFEGSCFLSNVRE----------TSNQIKGIEF----- 41   

                   LhLQeqfLSkILnqkDikIhdHLG.......vieERLkdqKVLIiLDDVD
                     LQ+++LS+IL   D kI   LG++++++++i+  L  ++V+I+LDDVD
  gi|1393709    42 --LQQRLLSEILE--DRKIQ--LGskeegtnTIRRSLASKRVFIVLDDVD 85   

                   dleQLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkee
                   ++eQL+ LA+   WFG GSRIIVTT D++LL+   In+  YeV+   ++e
  gi|1393709    86 NIEQLENLAGRRFWFGDGSRIIVTTRDQHLLEVGQINNR-YEVKVLNNQE 134  

                   ALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGksk
                    L+ FC+sAF+++ P   +e+L +++ +  +  LPL+L            
  gi|1393709   135 SLELFCQSAFRKSCPEKNYEDL-SNRAISCCKGLPLAL------------ 171  

                   eeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNg
                                                                     
  gi|1393709     - -------------------------------------------------- -    

                   ekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHn
                                                                     
  gi|1393709     - -------------------------------------------------- -    

                   LLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlG
                                                                     
  gi|1393709     - -------------------------------------------------- -    

                   IslDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                              
  gi|1393709     - ----------------------------------------    -    

gi|13897754|gb|AAK48438.1|AF255462_1: domain 1 of 1, from 1 to 170: score -119.8, E = 1.7e-06
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                +V           GKTT AR+
  gi|1389775     1    -------------------------GGV-----------GKTTLARV 11   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                      ++      ++F  s+F +n+r++                 e +    
  gi|1389775    12 VVKKIQ-----HQFDISCFLDNVREIS---------------KESD--GR 39   

                   LhLQeqfLSkILnqkDikIhdHL....GvieERLkdqKVLIiLDDVDdle
                    +LQ ++LS  L  k+++I+ +L++++ +i+E L  +KVL+++DDVDd  
  gi|1389775    40 IRLQGKLLSH-LAIKGLEIR-DLdegkNTIRELLFKKKVLLVIDDVDDTS 87   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   QL+ LA   +WFGpGSR+I+TT D q L +HgI  + Y+  +   +e Lq
  gi|1389775    88 QLECLAERLEWFGPGSRVIITTRDTQVLISHGIIEN-YKINLLNSDESLQ 136  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    + + AF+++ P + + eL ++ V+k aG LPL+L               
  gi|1389775   137 LLSQKAFKRDKPEEHYLEL-SKAVAKYAGGLPLAL--------------- 170  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                                                                     
  gi|1389775     - -------------------------------------------------- -    

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                                                                     
  gi|1389775     - -------------------------------------------------- -    

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                                                                     
  gi|1389775     - -------------------------------------------------- -    

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                           
  gi|1389775     - -------------------------------------    -    

gi|13194664|gb|AAK15497.1|AF325686_1: domain 1 of 1, from 1 to 169: score -122.7, E = 2.4e-06
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                +V           GKTT ARA
  gi|1319466     1    -------------------------GGV-----------GKTTLARA 11   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++ +      ++F   +F + +r                +   ++    
  gi|1319466    12 VYNSIA-----DQFKGLCFLDDVR---------------ENATKHG---L 38   

                   LhLQeqfLSkILnqkDikIh....dHLGvieERLkdqKVLIiLDDVDdle
                    hLQe++LS+I + kDikI + +++    i+ RL+ +K L+iLDDVD+le
  gi|1319466    39 IHLQEMLLSEIVGEKDIKIGsvskG-ISIIKHRLQRKKILLILDDVDKLE 87   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   QL A ++  +WFG+GSR+IVTT Dk+LL +Hg++ + YeV+   +ee L+
  gi|1319466    88 QLRATVGGPNWFGSGSRVIVTTRDKHLLASHGVDRK-YEVEDLNEEESLE 136  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    +C  AF+ +     ++++ + + +  a  LP                  
  gi|1319466   137 LLCWNAFKDDKVDPCYKDI-SSQAVAYASGLP------------------ 167  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                                                                     
  gi|1319466     - -------------------------------------------------- -    

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                                                ++                   
  gi|1319466   168 -----------------------------FT------------------- 169  

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                                                                     
  gi|1319466     - -------------------------------------------------- -    

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                           
  gi|1319466     - -------------------------------------    -    

gi|4519936|dbj|BAA75812.1|: domain 1 of 1, from 166 to 548: score -128.7, E = 4.9e-06
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         ddlVGiE+  + +   L  +  ++  ++ ++G  G GKTT    
  gi|4519936   166    ---DDLVGIEDNRKLLTDWLYSKE-QDNTIITVSGMGGLGKTTLVNN 208  

                   LfsqLSerhFqssFqlsaFmenlrgsysk.....eeigSgetrpaglDeY
                    + +       ++F+ s  +  ++ sy+  +  ++       r++ +D+ 
  gi|4519936   209 VYEREK-----NNFEVSTWIV-VSQSYDVvdllrK-----LLRKIVPDD- 246  

                   syGmKLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdl
                           Q q+L   L+  D+kI+     i+E Lkd   LI+LDDV + 
  gi|4519936   247 --------QTQLLD--LDAHDLKIR-----IKEKLKDENFLIVLDDVWNR 281  

                   eQLdALAketqWFGpGSRIIVTT.........eDkqLLkaHgInhtIYeV
                   e    +A+    F   SRII+TT++++  +  +    Lk    +ht    
  gi|4519936   282 EAYTQIADAFPNF-QASRIIITTrqgdvatlaQSARQLKLNPLEHT---- 326  

                   gfPSkeeALqIFCrsAFgQns.PpdGFeeLeAreVtkLaGnLPLGLrVlG
                         +AL+ FCr AF +n + p   e+L ++ ++ ++  LPL+    G
  gi|4519936   327 ------DALELFCRRAFYRNCkCPQNLEKL-TNDIVVRCQGLPLAIVSIG 369  

                   ...SsLRGkskeeWedmLpRLrtsfgnsL..DgkIekvLrvsYDgLhekD
                   +  SsL  ++ + W ++   Lr+     L+++ +++ +L  sY +L    
  gi|4519936   370 gllSSLPPEN-QVWNETYKQLRS----ELtkNNNVQAILNMSYHDLPGDL 414  

                   qaLFLhIACfFN.gek..vdyVkalLadsnnLDVrqGLkv.......Lad
                      FL+   f  ++e ++ + V  + a+       +  +++++++++ a+
  gi|4519936   415 RNCFLYCSLFPEdHELsrETVVRLWVAEG------FAVQNeentpeeVAE 458  

                   KS...LIhisplgned..kv..dgtieMHnLLqqLGReAIVrkQsidhde
                   K  ++LI+ ++l+   ++++++  t +MH+L + L+   I  +++++   
  gi|4519936   459 KYlreLIQRNMLEVLGndELgrVSTFKMHDLVRDLALS-IAKEEKFG--- 504  

                   PgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtseieeel.nIsekAF
                            a+      +++T  +             +++e++  s    
  gi|4519936   505 --------SAN------NYDTMER-------------MDKEVrRLSSYGW 527  

                   egMrNLq..FLriykksfrddgk<-*
                   +g + Lq +F r  +      g+   
  gi|4519936   528 KGKPVLQvkFMRLRTL--VALGM    548  

gi|4519938|dbj|BAA75813.1|: domain 1 of 1, from 166 to 548: score -128.8, E = 5e-06
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         ddlVGiE+  + +   L  +  ++  ++ ++G  G GKTT    
  gi|4519938   166    ---DDLVGIEDNRKLLTDWLYSKE-QDNTIITVSGMGGLGKTTLVNN 208  

                   LfsqLSerhFqssFqlsaFmenlrgsysk.....eeigSgetrpaglDeY
                    + +       ++F+ s  +  ++ sy+  +  ++       r++ +D+ 
  gi|4519938   209 VYEREK-----NNFEVSTWIV-VSQSYDVvdllrK-----LLRKIVPDD- 246  

                   syGmKLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdl
                           Q q+L   L+  D+kI+     i+E Lkd   LI+LDDV + 
  gi|4519938   247 --------QTQLLD--LDAHDLKIR-----IKEKLKDENFLIVLDDVWNR 281  

                   eQLdALAketqWFGpGSRIIVTT.........eDkqLLkaHgInhtIYeV
                   e    +A+    F   SRII+TT++++  +  +    Lk    +ht    
  gi|4519938   282 EAYTQIADAFPNF-QASRIIITTrqgdvatlaQSARQLKLNPLEHT---- 326  

                   gfPSkeeALqIFCrsAFgQns.PpdGFeeLeAreVtkLaGnLPLGLrVlG
                         +AL+ FCr AF +n + p   e+L ++ ++ ++  LPL+    G
  gi|4519938   327 ------DALELFCRRAFYRNCkCPQNLEKL-TNDIVVRCQGLPLAIVSIG 369  

                   ...SsLRGkskeeWedmLpRLrtsfgnsL..DgkIekvLrvsYDgLhekD
                   +  SsL  ++ + W ++   Lr+     L+++ +++ +L  sY +L    
  gi|4519938   370 gllSSLPPEN-HVWNETYKQLRS----ELtkNNNVQAILNMSYHDLPGDL 414  

                   qaLFLhIACfFN.gek..vdyVkalLadsnnLDVrqGLkv.......Lad
                      FL+   f  ++e ++ + V  + a+       +  +++++++++ a+
  gi|4519938   415 RNCFLYCSLFPEdHELsrETVVRLWVAEG------FAVQNeentpeeVAE 458  

                   KS...LIhisplgned..kv..dgtieMHnLLqqLGReAIVrkQsidhde
                   K  ++LI+ ++l+   ++++++  t +MH+L + L+   I  +++++   
  gi|4519938   459 KYlreLIQRNMLEVLGndELgrVSTFKMHDLVRDLALS-IAKEEKFG--- 504  

                   PgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtseieeel.nIsekAF
                            a+      +++T  +             +++e++  s    
  gi|4519938   505 --------SAN------NYDTMER-------------MDKEVrRLSSYGW 527  

                   egMrNLq..FLriykksfrddgk<-*
                   +g + Lq +F r  +      g+   
  gi|4519938   528 KGKPVLQvkFMRLRTL--VALGM    548  

gi|13897758|gb|AAK48440.1|AF255464_1: domain 1 of 1, from 1 to 170: score -129.1, E = 5.2e-06
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                +V           GKTT A A
  gi|1389775     1    -------------------------GGV-----------GKTTLALA 11   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++++      + F  s+F+ n+r           e++++   e      
  gi|1389775    12 VYNLIA-----DCFDGSCFIQNVR-----------EKSNKHGLE------ 39   

                   LhLQeqfLSkILnqkDikIh...dHLGvieERLkdqKVLIiLDDVDdleQ
                    hLQ  +LSkIL+ kDi I ++++    i++RL+ +KVL+iLD VD+ eQ
  gi|1389775    40 -HLQSILLSKILGDKDINIAsehEGISMIQQRLQRKKVLLILDNVDKCEQ 88   

                   LdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqI
                   L +LA+   WFGpGSR+I+TT D +LL +H ++ t YeV+   k++ALq 
  gi|1389775    89 LQTLAGSPDWFGPGSRVIITTRDTHLLASHQVKTT-YEVKTLNKDDALQL 137  

                   FCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWe
                   +   AF+       + e   + V+  a  LPL+L                
  gi|1389775   138 LTWKAFKTEHVDPRYVEV-LNDVVIYASGLPLAL---------------- 170  

                   dmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvd
                                                                     
  gi|1389775     - -------------------------------------------------- -    

                   yVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqq
                                                                     
  gi|1389775     - -------------------------------------------------- -    

                   LGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslD
                                                                     
  gi|1389775     - -------------------------------------------------- -    

                   tseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                          
  gi|1389775     - ------------------------------------    -    

gi|7107238|gb|AAF36333.1|AF186625_1: domain 1 of 1, from 1 to 170: score -129.1, E = 5.2e-06
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                           G+GKTTIA+A
  gi|7107238     1    -------------------------------------GVGKTTIAKA 10   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    +++       ++F+ + F  n+r+  +               e +   +
  gi|7107238    11 IYNKVG-----RDFEARSFLANIREVWE--------------QEAG---Q 38   

                   LhLQeqfLSkILnqkDikIhdHL....GvieERLkdqKVLIiLDDVDdle
                     LQe++   I++    kI  + ++++  ++ERL++++VL++LDDV++l+
  gi|7107238    39 MYLQEHLIYDIFKETTTKIQ-NIesgkSILKERLCHKRVLLVLDDVNKLD 87   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   QL+AL +  +WFG+GSRII+TT Dk++ +  ++n  +Y  +   + e  +
  gi|7107238    88 QLKALCGSRTWFGSGSRIIITTRDKHIIRGNRVNQ-VYNIKEMDERESIE 136  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    F  +AF+Q sP  +F e  +r ++k  G LPL+L               
  gi|7107238   137 LFSWHAFKQASPTKDFAES-SRNIVKYSGGLPLAL--------------- 170  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                                                                     
  gi|7107238     - -------------------------------------------------- -    

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                                                                     
  gi|7107238     - -------------------------------------------------- -    

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                                                                     
  gi|7107238     - -------------------------------------------------- -    

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                           
  gi|7107238     - -------------------------------------    -    

gi|10176995|dbj|BAB10245.1|: domain 1 of 1, from 164 to 536: score -129.5, E = 5.5e-06
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                     ++ LLc     + r  GI G +GIGKTT ARA
  gi|1017699   164    --------------DIQNLLCKQQ-WGLRTLGILGKPGIGKTTLARA 195  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    f +         +  s F+    + ys            +  e      
  gi|1017699   196 VFRRMV-----GGYDASHFVKDFHTRYS-----------EMTLEP----- 224  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                     L  +fL  ++  +    + + G  e+  ++++VLI+LDDV + +  dA
  gi|1017699   225 --LPAHFLC-MTQVEEFDLN-NSGS-EQCHRQKRVLIVLDDVRNEQ--DA 267  

                   LA..ketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIF
                   +   +e+  FGpGS II+T  D+q L+    n  IYe      e+A + F
  gi|1017699   268 MSflGEIDQFGPGSLIIITSRDRQVLEKCHLNE-IYELNGLNGEDARKLF 316  

                   CrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWed
                    r+AFg++       ++    V+k     P +Lr     ++Gk+ e+ ++
  gi|1017699   317 TRCAFGKDVIVKNLPMI----VIKGFEGNPSALRSYANKFKGKTTEDSMR 362  

                   mLpRLrtsfgnsLDgkIekvLrvsYDgLhek.DqaLFLhIACfFN.gekv
                   +L  ++       + k  ++    Y     ++++++FL   ++   + ++
  gi|1017699   363 IL--FKD---AVFNTK-KNTSMCIYSNIAIHeHKSIFLNKTVLHAiQNII 406  

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                    +++++   +        L + +  S+   ++          ++ H   q
  gi|1017699   407 FDLEEHPDLD--------LPNHVAESISDLRSP---------CVHHPSVQ 439  

                   q..LGReAIVrk..........QsidhdePgK........RqF.LvDaee
                    ++L +    r++    ++   Q    ++ +++ ++ ++ R+++L   e 
  gi|1017699   440 VqsLPKH-FHRRqlvllhglacQF---YKLWEgykrfsrlRKInLGHCEK 485  

                   IcdVLtdnTGtgtrsVlGIslDtseieeelnIsek..AF...egMrNLqF
                      V +                + ei+  l   ++ + F++++ + NLqF
  gi|1017699   486 LVQVVELSNACY----------LEEIN--LQDCKNldTFpdtDQLENLQF 523  

                   Lriykksfrddgk<-*
                   L   ++s ++  +   
  gi|1017699   524 LDLSNCSGIKYFQ    536  

gi|7649322|emb|CAB88868.1|: domain 1 of 1, from 1 to 170: score -130.2, E = 6e-06
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                +V           GKTT A+A
  gi|7649322     1    -------------------------GGV-----------GKTTLAKA 11   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L++++        F+  +F +n+r+           +   +         
  gi|7649322    12 LYNKIT-----YEFEACCFLSNVRE----------ASEQFNGLV------ 40   

                   LhLQeqfLSkILnqkDikIhdH....LGvieERLkdqKVLIiLDDVDdle
                    +LQe++LS+I++ +++k++ + +++   +++RL+ +KVLI+LDDVD+  
  gi|7649322    41 -QLQEKLLSEIFKDNNLKVD-NvhkgMNIMKDRLCSRKVLIVLDDVDKGR 88   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                     dAL++   WFG GS IIVTT D++LL+ +  +  I    +      L+
  gi|7649322    89 SIDALVGGRDWFGRGSKIIVTTRDRHLLERYSFDK-IHPIQLLDYVKSLE 137  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    FC +AF+Qn P  ++ +L ++ V++ +  LP                  
  gi|7649322   138 LFCWHAFKQNHPSRDYLDL-SELVVRYCNGLP------------------ 168  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                                                                     
  gi|7649322     - -------------------------------------------------- -    

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                                                                     
  gi|7649322   169 ------------------------------F------------------- 169  

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                        A                                            
  gi|7649322   170 -----A-------------------------------------------- 170  

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                           
  gi|7649322     - -------------------------------------    -    

gi|5903079|gb|AAD55637.1|AC008017_10: domain 1 of 1, from 180 to 363: score -130.8, E = 6.4e-06
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                          +lVGi+ H+ +++ L +L+s ++ rMVGIw   G   +  A+ 
  gi|5903079   180    SNGRNLVGIDKHMNELNRLMDLNSNKGKRMVGIWARGGSCRSALAKY 226  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    + q S       F  ++F +n++               ++  +Y   + 
  gi|5903079   227 VY-QTSC----QHFDSHCFLGNVK--------------RICQGNY---FE 254  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                    hL+++fL  I + +    +      ++ Lk qKVL++ DDVD+leQLdA
  gi|5903079   255 SHLHKEFLDNIQGEN----SS-----KQSLKKQKVLLVADDVDKLEQLDA 295  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   LA++ + FGpGS +I+TT+DkqLL ++gI + +Ye +f    + +q FCr
  gi|5903079   296 LAGDFSGFGPGSVVIITTKDKQLLISYGIQL-VYEAEF----LTFQKFCR 340  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   s          F  L                                   
  gi|5903079   341 S----------FRSL----------------------------------- 345  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                                                           F +++     
  gi|5903079   346 ----A-----------------------------------FKKRD----- 351  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                        +                   is                       
  gi|5903079   352 -----D-------------------IS----------------------- 354  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtse
                    A                                                
  gi|5903079   355 -A---------------------------------AF------------- 357  

                   iee.elnIsekAFegMrNLqFLriykksfrddgk<-*
                     e  l+I                             
  gi|5903079   358 --EwALYI--------------------------    363  

gi|7107254|gb|AAF36341.1|AF186633_1: domain 1 of 1, from 1 to 169: score -132.8, E = 8e-06
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                           G+GKTTIA+A
  gi|7107254     1    -------------------------------------GVGKTTIAKA 10   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++++      ++F+ + F  n+r+                  + +   K
  gi|7107254    11 IYNKIG-----RNFEGRSFLANIREVWR--------------QDTG---K 38   

                   LhLQeqfLSkILnqkDikIhdHL....GvieERLkdqKVLIiLDDVDdle
                    +LQeq+L  I +    +I+ + ++++  ++ERL  +KVL++LDDV+ l+
  gi|7107254    39 VNLQEQLLFDINKETKTRIR-NVesgkNILKERLSYKKVLLVLDDVNELD 87   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHg.InhtIYeVgfPSkeeAL
                   QL AL +  +WFGpGSRII+TT D+ +L+   +I +t+   +   ++e  
  gi|7107254    88 QLNALCGSDKWFGPGSRIIITTRDQDILRGRAdILYTMKGMD---EGESI 134  

                   qIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskee
                   + F  +AF+Q sP++ F +L +r V+   G LPL+L              
  gi|7107254   135 ELFSWHAFKQASPRENFTQL-SRNVIMYSGGLPLAL-------------- 169  

                   WedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgek
                                                                     
  gi|7107254     - -------------------------------------------------- -    

                   vdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLL
                                                                     
  gi|7107254     - -------------------------------------------------- -    

                   qqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIs
                                                                     
  gi|7107254     - -------------------------------------------------- -    

                   lDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                            
  gi|7107254     - --------------------------------------    -    

gi|5903080|gb|AAD55638.1|AC008017_11: domain 1 of 1, from 177 to 380: score -133.3, E = 8.6e-06
                   *->rDFddlVGiEaHlekmksLLcLds.kdeVrMVGIwGPaGIGKTTIAR
                      +   +lVGi+ H+++++ L +++ +k  VrMVGIw   G G +  A+
  gi|5903080   177    NNGKNLVGIDTHMKELNRLMHMNCnKVTVRMVGIWARGGDGRSALAK 223  

                   ALfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGm
                     + q S      +F  ++F +n+++              ++   +s   
  gi|5903080   224 YVY-QTSC----QQFDSHCFLGNVKT--------------ISQGRHS--- 251  

                   KLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLd
                     hL+ +fL  I + +    ++     ++ Lk+qKVL++ D V +++QL+
  gi|5903080   252 -AHLHDEFLRNIKRED----SN-----KQCLKNQKVLLVADNVTKVKQLE 291  

                   ALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFC
                   ALA++ + FGpGS +I+TT +k LL ++gI + +YeV+            
  gi|5903080   292 ALAGDFSSFGPGSVVIITTDNKGLLNSYGITD-VYEVE------------ 328  

                   rsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedm
                                 +L      k +G L                      
  gi|5903080   329 --------------HL------KFCGILR--------------------- 337  

                   LpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyV
                             sL g                           F ++     
  gi|5903080   338 ----------SL-G---------------------------FKKRA---- 345  

                   kalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLG
                       a+              ++ L + ++                   ++
  gi|5903080   346 ----AAF-------------QRALCRAKS-------------------FA 359  

                   ReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDts
                    e   + Qs                           ++          +s
  gi|5903080   360 TE-CFCCQS---------------------------SS----------IS 371  

                   eieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   + +                   ++       d     
  gi|5903080   372 GYG-------------------KVT------DLV    380  

gi|7489065|pir||T06403: domain 1 of 1, from 164 to 574: score -133.3, E = 8.6e-06
                   *->rDFddlVGiEaHlekmk.sLLcLdskdeVr...MVGIwGPaGIGKTT
                       D  ++ G +  +e++ + LL +d k  +++   V I G  G GKTT
  gi|7489065   164    VDDSGIFGRKNEIENLVgRLLSMDTK--RKnlaVVPIVGMGGMGKTT 208  

                   IARALfs..qLSerhFqssFqlsaFmenlrgsysk........eeigSge
                    A+A +++++       + F l+a    +++ y+  + +++  +eigS  
  gi|7489065   209 LAKAVYNdeRVQ-----KHFGLTAWFC-VSEAYDAfritkgllQEIGS-- 250  

                   trpaglDeYsyGmKLhLQeqfLSkILnqkDikIhdHLGv.ieERLkdqKV
                   t  +  D+ +     +LQ ++      + D   + +L v+++E L+ ++ 
  gi|7489065   251 TDLKADDNLN-----QLQVKL------KADDNLN-QLQVkLKEKLNGKRF 288  

                   LIiLDDV........DdleQLdALAketqWFGpGSRIIVTTeDkqLLkaH
                   L++LDDV +++ ++ Ddl  L    +       GS IIVTT         
  gi|7489065   289 LVVLDDVwndnypewDDLRNLFLQGD------IGSKIIVTTRKESVALMM 332  

                   gInhtIYeVgfPSkeeALqIFCrsAFgQnsPp..dGFeeLeAreVtkLaG
                   +    IY  g  S e+    F r+   ++ P+++  Fee   ++++  + 
  gi|7489065   333 DSGA-IYM-GILSSEDSWALFKRHSLEHKDPKehPEFEEV-GKQIADKCK 379  

                   nLPLGLrVlGSsLRGksk.eeWedmLp....RLrtsfgnsLDgkIekvLr
                    LPL+L+ l   LR ks+ +eW ++L+++  +L +    + +g I   L 
  gi|7489065   380 GLPLALKALAGMLRSKSEvDEWRNILRseiwELPS----CSNG-ILPALM 424  

                   vsYDgLhekDqaLFLhIACf...FNgekvdyVkalLadsnnLDVrqGLkv
                    sY++L  + +  F + A+ +++   +k   ++ ++a+       + ++ 
  gi|7489065   425 LSYNDLPAHLKQCFAYCAIYpkdYQFRKEQVIHLWIANG----LVHQFHS 470  

                   .......LadKSLIhisplgnedkvdgtie...MHnLLqqLGReAIVrkQ
                   +++   +L  +SL  + ++  e    + +e+  MH+L   L+  A   ++
  gi|7489065   471 gnqyfieLRSRSLFEMASEPSE----RDVEeflMHDLVNDLAQIA-SSNH 515  

                   sidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslD.....tseie
                   +i                    L+dn+G+         l++ ++  + i+
  gi|7489065   516 CI-------------------RLEDNKGSH-------MLEqcrhmSYSIG 539  

                   e..elnIsekAF..egMrNLqFLriykksfrddgk<-*
                   +++e+   ++ F++e +r L+   i  +++++  k   
  gi|7489065   540 QdgEFEKLKSLFksEQLRTLLPIDIQFHYSKKLSK    574  

gi|14589374|gb|AAK70629.1|AC091238_7: domain 1 of 1, from 164 to 588: score -134.7, E = 1e-05
                   *->rDFddlVGiEaHlekmks.LLcLdskdeVrMVGIwGPaGIGKTTIAR
                          d+VG +  ++ +ks LL+ ++      + I G+aG GK+T A+
  gi|1458937   164    ----DIVGFDHEIAQIKSyLLDQNN-MNLTVISIVGQAGAGKSTLAK 205  

                   ALfsqLSerhFq.ssFqlsaFmenlrgsyskeeigSg.etrpaglDeYsy
                     +s        +  F+    ++ ++  ys  e+     + + g    s 
  gi|1458937   206 LAYSSVI----TeGYFHKYGWVS-ISPKYSALEVLRDlVRQIRGTGKIS- 249  

                   GmKLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDV.....
                       + + +f          +++  L  i + Lk  + LI+LDD+ ++++
  gi|1458937   250 -ERKSMHLNF------YGETEVS-KL--IFDFLKEERYLIVLDDIwttdt 289  

                   .DdleQLdALAketqWFGpGSRIIVTTeDkqLLkaH.....gInhtIYeV
                    D+++   +  ++    G+GSRII TT D +   +H++++  I       
  gi|1458937   290 wDKIK--SVFPDK----GNGSRIILTTRDMEV-GQHpktkvQIHTP---- 328  

                   gfPSkeeALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGS
                   ++  ++   + F   AF ++      e    ++  k +  LPL+L VlG 
  gi|1458937   329 DLLDEDKSWELFQKKAFPHDVQFTELEVV-GKKLSKKCNGLPLALVVLGC 377  

                   sLRG.kskeeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFL
                    L ++ + + We+m             g++  +L  sY   +++ +a FL
  gi|1458937   378 FLSRnHNIHTWEKMVASVDW-EIMKKEGDVGRILALSYHNMSNNLKACFL 426  

                   hIACfFN.gekvdyV..kalLadsnnL.........DVrqG.LkvLadKS
                   + A f  ++ +  +V +k ++a+  ++++ ++ +++ V ++  + La+++
  gi|1458937   427 YTASFPEdYPITVHVlkKMWIAEG-FVpnirgytqeEVAYRyVEELAQRC 475  

                   LIhisplgnedkv..dgtieMHnLLqqLGReAIVrk..............
                    I+i++ +++  ++  + i+ H+ L++ G     rk++  +  +++++ +
  gi|1458937   476 MIQIEERSKN--IgwIKKIKVHDVLREWGIG-QARKegflkvcssgtdve 522  

                   ......QsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtse
                   +   ++Q  + +        v ++     ++++ G +        l+++ 
  gi|1458937   523 tyyadeQRCY-R--------VAFH---GYFDNEVGKS-------VLNLRS 553  

                   ieeelnIsek...AFegMrNLqFLriykksfrddgk<-*
                   +   +n + k+  +F g++ L+ L++  +++ ++ +   
  gi|1458937   554 VL-AFNPDGKrlfSFNGLHLLRVLHFCSSLKTCTLP    588  

gi|13194662|gb|AAK15496.1|AF325685_1: domain 1 of 1, from 1 to 169: score -134.8, E = 1e-05
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                +V           GKTTIAR 
  gi|1319466     1    -------------------------GGV-----------GKTTIARE 11   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++++      ++F+  +F +n+r++           +++gl        
  gi|1319466    12 VYNLIA-----DQFEWLCFLDNVRENS----------IKHGLV------- 39   

                   LhLQeqfLSkILnqkDik...IhdHLGvieERLkdqKVLIiLDDVDdleQ
                    hLQ+ +LSk ++   ik +++h+    i+ R + +KVL++ DDVDdl+Q
  gi|1319466    40 -HLQKTLLSKTIGESSIKlgsVHEGIPIIKHRFHLKKVLLVVDDVDDLDQ 88   

                   LdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqI
                   L A+++ t WFG+GSR+I+TT Dk+LL  Hg+  t YeV+   keeAL+ 
  gi|1319466    89 LQAIVGGTDWFGSGSRVIITTRDKHLLTCHGVTST-YEVDGLNKEEALKL 137  

                   FCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWe
                   +   AF+ +     ++ +  ++V++ a  LP                   
  gi|1319466   138 LSGTAFKIDKVDPCYMRI-LNRVVTYASGLP------------------- 167  

                   dmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvd
                                                                     
  gi|1319466     - -------------------------------------------------- -    

                   yVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqq
                                                                     
  gi|1319466   168 -----------------------------F-------------------- 168  

                   LGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslD
                       A                                             
  gi|1319466   169 ----A--------------------------------------------- 169  

                   tseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                          
  gi|1319466     - ------------------------------------    -    

gi|7488662|pir||T08819: domain 1 of 1, from 1 to 169: score -136.8, E = 1.3e-05
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                +V           GKTT A A
  gi|7488662     1    -------------------------GGV-----------GKTTLALA 11   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++++        F  s+F  n+r                +++ ++  +K
  gi|7488662    12 VYNLIA-----LHFDESCFLQNVR---------------EESNKHG--LK 39   

                   LhLQeqfLSkILnqkDikIh...dHLGvieERLkdqKVLIiLDDVDdleQ
                    hLQ   LSk+L+ kDi   + ++    i+ RL+ +KVL+iLDDVD+ +Q
  gi|7488662    40 -HLQSIILSKLLGEKDINLTswqEGASMIQHRLQRKKVLLILDDVDKRQQ 88   

                   LdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqI
                   L+A+++   WFGpGSR+I+TT Dk++Lk H+++ t YeV+   +  ALq 
  gi|7488662    89 LKAIVGRPDWFGPGSRVIITTRDKHILKYHEVERT-YEVKVLNQSAALQL 137  

                   FCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWe
                   +   AF++      +e+   ++V++ a  LPL                  
  gi|7488662   138 LKWNAFKREKNDPSYEDV-LNRVVTYASGLPL------------------ 168  

                   dmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvd
                                                                     
  gi|7488662     - -------------------------------------------------- -    

                   yVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqq
                                                                     
  gi|7488662     - -------------------------------------------------- -    

                   LGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslD
                       A                                             
  gi|7488662   169 ----A--------------------------------------------- 169  

                   tseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                          
  gi|7488662     - ------------------------------------    -    

gi|13897756|gb|AAK48439.1|AF255463_1: domain 1 of 1, from 1 to 168: score -138.7, E = 1.6e-05
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                +V           GKTT ARA
  gi|1389775     1    -------------------------GGV-----------GKTTLARA 11   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++ +      ++F+  +F + +r                +   ++    
  gi|1389775    12 VYNSIA-----DQFEGLCFLDGVR---------------ENAVKHG---L 38   

                   LhLQeqfLSkILnqkDikIh....dHLGvieERLkdqKVLIiLDDVDdle
                    hLQe++LS+I + kDikI + +++    i+ RL+ +KVL+iLDDVD+le
  gi|1389775    39 VHLQEMLLSEIVGEKDIKIGsvskG-ISIIKHRLHRKKVLLILDDVDKLE 87   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   Q  A ++  +WFG+GSR+I+TT Dk+LL+  g++ + Ye +   +eeAL+
  gi|1389775    88 QVRATVGVPNWFGSGSRVIITTRDKHLLQ--GVDGK-YEIEDLNEEEALE 134  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    +   AF+ +     ++++ +++ +  a  LPL+L               
  gi|1389775   135 LLSWNAFKDDKVDPSYKDI-SNQAVAYASGLPLAL--------------- 168  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                                                                     
  gi|1389775     - -------------------------------------------------- -    

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                                                                     
  gi|1389775     - -------------------------------------------------- -    

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                                                                     
  gi|1389775     - -------------------------------------------------- -    

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                           
  gi|1389775     - -------------------------------------    -    

gi|7107240|gb|AAF36334.1|AF186626_1: domain 1 of 1, from 1 to 170: score -141.3, E = 2.2e-05
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                           G+GKTTIA+A
  gi|7107240     1    -------------------------------------GVGKTTIAKA 10   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++q+      +sF  + F  n+r+              ++  + +   +
  gi|7107240    11 IYNQIG-----RSFNYRSFLANIRE--------------ICEQNVG---Q 38   

                   LhLQeqfLSkILnqkDikIhdHLGv....ieERLkdqKVLIiLDDVDdle
                    +LQ+q+L    +    kI  +  +++  +++RL++++VL++LDDV  l+
  gi|7107240    39 VSLQQQLLFDTCKETKTKIQ-NIEAgkiiLKDRLQNKRVLVVLDDVSTLD 87   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   QL AL +  qWFG+GS II+TT D q+Lk  +++  IY  +   k e  +
  gi|7107240    88 QLHALCGSRQWFGSGSKIIITTRDMQILKGDRVDQ-IYRMKEMDKSESVE 136  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    F   AF+Q  P+    e  + eV++  G LPL+L               
  gi|7107240   137 LFSWNAFKQAKPRKELAEF-SLEVVEYSGGLPLAL--------------- 170  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                                                                     
  gi|7107240     - -------------------------------------------------- -    

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                                                                     
  gi|7107240     - -------------------------------------------------- -    

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                                                                     
  gi|7107240     - -------------------------------------------------- -    

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                           
  gi|7107240     - -------------------------------------    -    

gi|7486805|pir||T05746: domain 1 of 1, from 122 to 503: score -141.5, E = 2.3e-05
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                  l k+k +L  ++  +   +G+wG  G+GKTT  R 
  gi|7486805   122    ------------LDKLKDCLKKKN-VQK--IGVWGMGGVGKTTLVRT 153  

                   LfsqLSerhFq.ssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGm
                   L + L  +   + +F l + ++ ++               +  D     +
  gi|7486805   154 LNNDLL-KYAAtQQFALVIWVTVSKDFD---------LKRVQMDI----A 189  

                   KLhLQeqfLSkILnqkDikIhdHLGvieERLkdqK.VLIiLDDV...Ddl
                   K +L ++f  + +nq ++ I+       ERL d K+ L+iLDDV ++ dl
  gi|7486805   190 K-RLGKRFTREQMNQLGLTIC-------ERLIDLKnFLLILDDVwhpIDL 231  

                   eQL.dALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeA
                   +QL+  LA e +     S ++ T    +  ++   n +  +V    ++eA
  gi|7486805   232 DQLgIPLALERS---KDSKVVLTSRRLEVCQQMMTNEN-IKVACLQEKEA 277  

                   LqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkske
                    + FC +  g+    d  + + A+ V + +  LPL+    G  LRGk + 
  gi|7486805   278 WELFC-HNVGEVANSDNVKPI-AKDVSHECCGLPLAIITIGRTLRGKPQV 325  

                   e.WedmLpRLrtsfgnsLD..gkIekvLrvsYDgLhekDqaLFLhIACfF
                   e W+ +L  L+ s   s+D+++kI  +L+ sYD L ++ ++ FL  A f 
  gi|7486805   326 EvWKHTLNLLKRS-APSIDteEKIFGTLKLSYDFLQDNMKSCFLFCALFP 374  

                   N.gekv..dyVkalLadsnnLDVrqGLk.......vLadK....SLIhis
                    ++++  ++++  + a+   LD ++  ++  +++ +L+++ ++++L   +
  gi|7486805   375 EdYSIKvsELIMYWVAEG-LLDGQHHYEdmmnegvTLVERlkdsCLLE-D 422  

                   plgnedkvdgtieMHnLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIc
                     +     ++t++MH+  + ++       Q       g +   +  +   
  gi|7486805   423 GDS-----CDTVKMHDVVRDFAIW-FMSSQG-----EGFHSLVMAGR--- 458  

                   dVLtdnTGtgtrsVlGIslDtseieeelnIsekAFegMrNLqFLriykks
                      +   +            +s ++  ++   + +e+++N     + +  
  gi|7486805   459 GLIEFPQDKF----------VSSVQ-RVSLMANKLERLPNNVIEGVETLV 497  

                   frddgk<-*
                      +g+   
  gi|7486805   498 LLLQGN    503  

gi|7107242|gb|AAF36335.1|AF186627_1: domain 1 of 1, from 1 to 170: score -142.2, E = 2.5e-05
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                           G+GKTT ARA
  gi|7107242     1    -------------------------------------GVGKTTTARA 10   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++q++      +F ++ F+en+r      e+  +         Y+ G  
  gi|7107242    11 IYNQIH-----CKFVDHSFIENIR------ETCKK---------YD-GEI 39   

                   LhLQeqfLSkILnqkDikIhdH....LGvieERLkdqKVLIiLDDVDdle
                    hLQeq+LS +L+  + kIh ++  +  +ie R   ++ LI+LDDV  +e
  gi|7107242    40 THLQEQLLSNVLK-TNEKIH-NtafgITTIEKRFSGKRALIVLDDVTTIE 87   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   Q +AL +  ++FG+GS  IVTT D  +Lk   +++ IY  +   +   L+
  gi|7107242    88 QVEALCGNRKCFGSGSVLIVTTRDXRILKLLKVDC-IYSIKQMDENKSLE 136  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    F  +AF++  P+++F eL +r ++  +G LPL+L               
  gi|7107242   137 LFSWHAFRKPCPKEDFSEL-SRSIVSYCGGLPLAL--------------- 170  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                                                                     
  gi|7107242     - -------------------------------------------------- -    

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                                                                     
  gi|7107242     - -------------------------------------------------- -    

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                                                                     
  gi|7107242     - -------------------------------------------------- -    

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                           
  gi|7107242     - -------------------------------------    -    

gi|7107246|gb|AAF36337.1|AF186629_1: domain 1 of 1, from 1 to 170: score -143.0, E = 2.7e-05
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                           G+GKTTIA+A
  gi|7107246     1    -------------------------------------GVGKTTIAKA 10   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++++      ++F+ + F  n+r      ei  +       D+     K
  gi|7107246    11 AYNKIR-----RDFEAKSFLLNVR------EIWEQ-------DN----GK 38   

                   LhLQeqfLSkILnqkDikIhdHLG....vieERLkdqKVLIiLDDVDdle
                    +LQ+++LS I +   ikI+    +++  ++ERL+++K +++LDDV++l+
  gi|7107246    39 ISLQQRLLSDIYKTTKIKID-TVEsgkmILQERLRQKKIFLVLDDVNKLD 87   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   QL AL +  +WFG GS II+TT D  LL    +++ +Y  +     e  +
  gi|7107246    88 QLNALCGSRKWFGQGSKIIITTRDDDLLCRLKVDC-VYRMKEMDGNESIE 136  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    F  +AF+Q  P +GF +L +r V+k  G LPL+L               
  gi|7107246   137 LFSWHAFKQPDPFEGFADL-SRDVVKYSGGLPLAL--------------- 170  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                                                                     
  gi|7107246     - -------------------------------------------------- -    

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                                                                     
  gi|7107246     - -------------------------------------------------- -    

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                                                                     
  gi|7107246     - -------------------------------------------------- -    

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                           
  gi|7107246     - -------------------------------------    -    

gi|7443914|pir||T06049: domain 1 of 1, from 152 to 535: score -145.5, E = 3.6e-05
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                  l+k++    L s+++ ++ G+wG  G+GKTT  R 
  gi|7443914   152    ------------LAKIRD--GLTSEKAQKI-GVWGMGGVGKTTLVRT 183  

                   LfsqLSerhFq.ssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGm
                   L ++L   +  +  F l +F+  ++                ++D +   +
  gi|7443914   184 LNNKLR-EEGAtQPFGLVIFVIVSK----------------EFDPRE--V 214  

                   KLhLQeqfLSkILnqkD.......ikIhdHLGvieERLkdqKVLIiLDDV
                   + +  e++   I  q  +++++   +I    G ++ER    K L+iLDDV
  gi|7443914   215 QKQIAERL--DIDTQMEeseeklaRRIY--VGLMKER----KFLLILDDV 256  

                   DdleQLdAL....AketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgf
                    +   Ld L+ ++  e +    GS +I T    +  ++   ++    V+ 
  gi|7443914   257 WKPIDLDLLgiprTEENK----GSKVILTSRFLEVCRSMKTDLD-VRVDC 301  

                   PSkeeALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsL
                     +e+A + FC  A g     d   ++ A+ V   +G LPL+   +G ++
  gi|7443914   302 LLEEDAWELFCKNA-GDVVRSDHVRKI-AKAVSQECGGLPLAIITVGTAM 349  

                   RG.kskeeWedmLpRLrtsf..gnsLDgkIekvLrvsYDgLhekDqaLFL
                   RG+k+ + W  +L  L +s++  +s+ +kI   L+ sYD L +k +  FL
  gi|7443914   350 RGkKNVKLWNHVLSKLSKSVpwIKSIEEKIFQPLKLSYDFLEDKAKFCFL 399  

                   hIACfFN.gekv..dyVkalLadsnnLD........VrqGLkv...LadK
                   + A f  ++++  ++ V  + a+  +  + ++++++++ G ++ ++L d 
  gi|7443914   400 LCALFPEdYSIEvtEVVRYWMAEG-FMEelgsqedsMNEGITTvesLKDY 448  

                   SLIhisplgnedkvdgtieMHnLLqqLGReAIVrk.QsidhdePgKRqFL
                   +L   +  g++    +t++MH+  + ++   I   +Q             
  gi|7443914   449 CLLE-D--GDR---RDTVKMHDVVRDFAIW-IMSSsQD------------ 479  

                   vDaeeIcdVLtdnTGtgtrsVlGIslD.tseieeelnIsekAFegMrNLq
                       + +     +TG +      I+ D++    + ++   + +e +++L 
  gi|7443914   480 ----DSHSLVMSGTGLQD-----IRQDkLAPSLRRVSLMNNKLESLPDLV 520  

                   .FLriykksfrddgk<-*
                   +   ++++    +g+   
  gi|7443914   521 eEFCVKTSVLLLQGN    535  

gi|13897764|gb|AAK48443.1|AF255467_1: domain 1 of 1, from 1 to 169: score -145.5, E = 3.7e-05
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                +V           GKT  A A
  gi|1389776     1    -------------------------GGV-----------GKTALALA 11   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++++      + F  s+F+ n+r           e +++   e      
  gi|1389776    12 VYNLIA-----DCFDGSCFIQNVR-----------EISNKHGLE------ 39   

                   LhLQeqfLSkILnqkDikIh...dHLGvieERLkdqKVLIiLDDVDdleQ
                    hLQ  +LSk+L+ kDi   ++++   vi++RL+ +KVL+iLD VD+ eQ
  gi|1389776    40 -HLQSILLSKLLGDKDINLAsehEGISVIQQRLQRKKVLLILDNVDKCEQ 88   

                   LdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqI
                   L +LA+   WFGpGSR+I+TT D +LL +H ++ t YeV+   k++ALq 
  gi|1389776    89 LQTLAGSPDWFGPGSRVIITTRDTHLLASHQVKTT-YEVKTLNKDDALQL 137  

                   FCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWe
                   +   AF+       + e   + V+  a  LPL                  
  gi|1389776   138 LTWKAFKTEHVDPRYVEV-LNDVVIYASGLPL------------------ 168  

                   dmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvd
                                                                     
  gi|1389776     - -------------------------------------------------- -    

                   yVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqq
                                                                     
  gi|1389776     - -------------------------------------------------- -    

                   LGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslD
                       A                                             
  gi|1389776   169 ----A--------------------------------------------- 169  

                   tseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                          
  gi|1389776     - ------------------------------------    -    

gi|13897762|gb|AAK48442.1|AF255466_1: domain 1 of 1, from 1 to 169: score -146.3, E = 4e-05
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                +V           GKTT A A
  gi|1389776     1    -------------------------GGV-----------GKTTLALA 11   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L++++        F  s+F +n+r              +++ D       
  gi|1389776    12 LYNLIA-----GCFDGSCFLGNVR-------------EKSNKDGPE---- 39   

                   LhLQeqfLSkILnqkDikIh...dHLGvieERLkdqKVLIiLDDVDdleQ
                    hLQ  +LSkIL+ kDik  ++++    i+ RL+ +KVL+iLDDVD+ eQ
  gi|1389776    40 -HLQSILLSKILGEKDIKLAskhEGISMIQRRLQRKKVLLILDDVDKCEQ 88   

                   LdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqI
                   L ALA+   WFGpGSR+++TT D qLL +H ++ t YeV           
  gi|1389776    89 LQALAGSPDWFGPGSRVVITTRDTQLLASHHVKET-YEVM---------- 127  

                   FCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWe
                           +  +d+                                    
  gi|1389776   128 --------TLNKDD----A------------------------------- 134  

                   dmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvd
                       RL t                 + +   +               +++
  gi|1389776   135 ---SRLLT-----------------WKAFQTEQ-------------VDAS 151  

                   yVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqq
                   yV+                      L h                      
  gi|1389776   152 YVE---------------------VLNH---------------------- 158  

                   LGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslD
                       A                            t+++G            
  gi|1389776   159 ----A---------------------------VTYASG------------ 165  

                   tseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                          L               
  gi|1389776   166 -----------------------LPLA---------    169  

gi|8927667|gb|AAF82158.1|AC034256_22: domain 1 of 1, from 226 to 605: score -146.8, E = 4.3e-05
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         d +VG     ++ +sL     kde+r  G +G  G+GKTT    
  gi|8927667   226    VGLDAMVG-----RAWNSLM----KDERRTLGLYGMGGVGKTTLLAS 263  

                   LfsqLSerhFq.ssFqlsaFmenlrgsysk...eeigSgetrpaglDeYs
                     +++ e     + F l + +  ++ ++ ++ +e+i ++     gl+ ++
  gi|8927667   264 INNKFLE---GmNGFDLVIWVVVSKDLQNEgiqEQILGR----LGLH-RG 305  

                   yGmKLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdle
                     +K         +++ +     +     i + L+ +K  + LDD+   +
  gi|8927667   306 --WK---------QVTEK-----E-KASYICNILNVKKFVLLLDDLWSEV 338  

                   QLd.....ALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSk
                    L++ + + L  e     +GS I+ TT  k   +  +++ +  +V+    
  gi|8927667   339 DLEkigvpPLTRE-----NGSKIVFTTRSKDVCRDMEVDGE-MKVDCLPP 382  

                   eeALqIFCrsAFgQn......sPpdGFeeLeAreVtkLaGnLPLGLrVlG
                   +eA +      F ++ ++ + + +++   L Ar+V++ +  LPL+L+V G
  gi|8927667   383 DEAWEL-----FQKKvgpiplQSHEDIPTL-ARKVAEKCCGLPLALSVIG 426  

                   SsLR.GkskeeWedmLpRLrtsfgn..sLDgkIekvLrvsYDgLhek.Dq
                    ++ ++++ +eW  +++ L +s  + +s  +kI  vL++sYD+L +++ +
  gi|8927667   427 KAMAsRETVQEWQHVIHVLNSSSHEfpSMEEKILPVLKFSYDDLKDEkVK 476  

                   aLFLhIACfFN.ge..kvdyVkalLadsnnLDVrqGLkvLadKSLIhisp
                     FL+   f  ++e +k ++++ +  +                    i+ 
  gi|8927667   477 LCFLYCSLFPEdYEvrKEELIEYWMCEG------------------FIDG 508  

                   lgne.....................d.kvdgtieMHnLLqqLGReAIVrk
                   +++e++ ++++++  ++  + +   d+++   ++MH+  ++++   I   
  gi|8927667   509 NEDEdgannkghdiigslvrahllmDgELTTKVKMHDVIREMALW-I--- 554  

                   QsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtseieeeln
                         + gK +         + L  + G +          ++ i  + +
  gi|8927667   555 ----ASNFGKQK---------ETLCVKPGVQ----------LCHIP-K-D 579  

                   IsekAFegMrNLqFLriykksfrddgk<-*
                   I+ +++++M+ L    i + s+++  +   
  gi|8927667   580 INWESLRRMS-LMCNQIANISSSSNSP    605  

gi|7489239|pir||T07769: domain 1 of 1, from 1 to 154: score -147.5, E = 4.6e-05
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                                  AR+
  gi|7489239     1    -----------------------L--------------------ARV 4    

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++ +      s+Fq  +F   +r                   ++s  +K
  gi|7489239     5 IYDNIR-----SQFQGACFLHEVR-------------------DRS--AK 28   

                   L...hLQeqfLSkILnqkDikIhdHLGvi...eERLkdqKVLIiLDDVDd
                    + ++LQe +LS+IL  k+++I+d +  ++ +++RL+ +KVL++LDDVD+
  gi|7489239    29 QgleRLQEILLSEILVVKNLRINDSFEGAnmrKQRLRYKKVLLVLDDVDH 78   

                   leQLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeA
                   +eQLdALA+e +WFG GSRII+TT+Dk+LL  ++ +  IY  g   k+e 
  gi|7489239    79 IEQLDALAGEREWFGDGSRIIITTKDKHLLVKYETEK-IYRMGTLYKYES 127  

                   LqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkske
                   Lq F ++AF++n P   Fe+L                             
  gi|7489239   128 LQLFKQHAFKKNHPTKEFEDL----------------------------- 148  

                   eWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNge
                                                                     
  gi|7489239     - -------------------------------------------------- -    

                   kvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnL
                              s                                      
  gi|7489239   149 -----------S-------------------------------------- 149  

                   LqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGI
                          A    Q i                           +       
  gi|7489239   150 -------A----QVI---------------------------E------- 154  

                   slDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                             
  gi|7489239     - ---------------------------------------    -    

gi|5903083|gb|AAD55641.1|AC008017_14: domain 1 of 1, from 180 to 369: score -149.5, E = 5.9e-05
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                          +lVGi+ H+++++  L+L+s +  r VGIw     G +  A+ 
  gi|5903083   180    SNGKNLVGIDTHMKALNKKLDLNSNKSLRVVGIWARGYNGRSALAKY 226  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    +  +      + F  ++F + ++             r++     s    
  gi|5903083   227 VYQDIC-----HHFDSHCFLGSVK-------------RISQGRHLS---- 254  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                    hL+e+fL  I + k    h +L       kdqKVL++ DDV +leQLdA
  gi|5903083   255 -HLHEEFLIRIQGSK----H-NL-------KDQKVLLVADDVYKLEQLDA 291  

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   LA + + FGpGS +I+TT+Dk+L+ + gI++ +YeV+             
  gi|5903083   292 LAEDFNGFGPGSVVIITTQDKHLFVSAGIKL-VYEVE------------- 327  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                                 L                                   
  gi|5903083   328 --------------L----------------------------------- 328  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                                     L++                     ++ +++  
  gi|5903083   329 ------------------LKF---------------------QKVCELFR 339  

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                   ++  ++                                           R
  gi|5903083   340 QFAFKK-------------------------------------------R 346  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtse
                   + I                                 +             
  gi|5903083   347 D-I---------------------------------S-----------AA 351  

                   ieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   ++               L + r  +++   +g    
  gi|5903083   352 VK---------------LVYYRATNWLGCLSGR    369  

gi|13937096|gb|AAK50047.1|AF363802_1: domain 1 of 1, from 1 to 166: score -150.2, E = 6.4e-05
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                +V           GKTTIAR 
  gi|1393709     1    -------------------------GGV-----------GKTTIARL 11   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    +         ++F  s+F en+r+           + ++gl        
  gi|1393709    12 VYEAVK-----EKFKVSCFLENIRE----------LSKTNGLV------- 39   

                   LhLQeqfLSkI.LnqkDikIhdHLG..vieERLkdqKVLIiLDDVDdleQ
                    h Q++ LS ++ +     I    G++ i + L ++KVL++LDDV d+ Q
  gi|1393709    40 -HIQKEILSHLnVRRMIFVIF-MMGkkIIANSLSNKKVLLVLDDVSDISQ 87   

                   LdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqI
                   L+ L ++ +WFGpGSR I+TT Dk+LLk +g++ t Y+     + eALq 
  gi|1393709    88 LENLGGKREWFGPGSRLIITTRDKHLLKTYGVDMT-YKARGLAQNEALQL 136  

                   FCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWe
                   FC+ AF+Q++P++G+ +L ++ V++ a  LP                   
  gi|1393709   137 FCLKAFKQDQPKEGYLNL-CKGVVEYARGLP------------------- 166  

                   dmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvd
                                                                     
  gi|1393709     - -------------------------------------------------- -    

                   yVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqq
                                                                     
  gi|1393709     - -------------------------------------------------- -    

                   LGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslD
                                                                     
  gi|1393709     - -------------------------------------------------- -    

                   tseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                          
  gi|1393709     - ------------------------------------    -    

gi|4689223|gb|AAD27815.1|AF118127_1: domain 1 of 1, from 165 to 539: score -150.2, E = 6.4e-05
                   *->rDFddlVGiEaHlekmksLLcLdskdeVr..MVGIwGPaGIGKTTIA
                       D  d+ G    +e +   L  +   + + + V I G  G GKTT A
  gi|4689223   165    DDESDIFGRQSEIEDLIDRLLSEGASGKKltVVPIVGMGGQGKTTLA 211  

                   RALfs..qLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYs
                   +A +++++       + F l+a    ++                g+D   
  gi|4689223   212 KAVYNdeRVK-----NHFDLKAWYC-VS---------------EGFDA-- 238  

                   yGmKLhLQeqfLSkI..LnqkDi..kIhdHLGv.ieERLkdqKVLIiLDD
                       L+  +++L +I++++ kD+++  + +L v+++E Lk +K LI+LDD
  gi|4689223   239 ----LRITKELLQEIgkFDSKDVhnNLN-QLQVkLKESLKGKKFLIVLDD 283  

                   V........DdleQLdALAketqWFGpGSRIIVTTeD..kqLLkaHg.In
                   V +++ ++ +dl    A  +       GS IIVTT  ++  L++  ++I 
  gi|4689223   284 VwnenynewNDLRNIFAQGD------IGSKIIVTTRKdsVALMMGNEqIR 327  

                   htIYeVgfPSkeeALqIFCrsAFgQnsPp..dGFeeLeAreVtkLaGnLP
                         g  S+e     F r+AF  + P ++   ee   r+++  +  LP
  gi|4689223   328 M-----GNLSTEASWSLFQRHAFENMDPMghPELEEV-GRQIAAKCKGLP 371  

                   LGLrVlGSsLRGksk.eeWedmLp.RLrtsfgnsLDgkIekvLrvsYDgL
                   L+L+ l   LR ks+ eeW+++L++++        + +I   L  sY++L
  gi|4689223   372 LALKTLAGMLRSKSEvEEWKRILRsEIWE----LPHNDILPALMLSYNDL 417  

                   hekDqaLFLhIACf.....FNgekvdyVkalLadsnnLDVrqGLkvLadK
                     + +  F   A+f+++ +F++e    ++ ++a+                
  gi|4689223   418 PAHLKRCFSFCAIFpkdypFRKEQ--VIHLWIANG--------------- 450  

                   SLIhisplgnedkvdgtieMHnLLqqLGReAIVrk.......QsidhdeP
                    L+ ++++ n              q LG +    + ++++  +++   +P
  gi|4689223   451 -LVPVKDEIN--------------QDLGNQ-YFLElrsrslfEKV--PNP 482  

                   gKRqF..LvDaeeIcdVLtdnTGtgtrsVlGIslDtseieeelnIsekAF
                    KR +++L+  ++  + L+    ++    l I+l+ s  +   ++    +
  gi|4689223   483 SKRNIeeLFLMHDLVNDLAQLASSK----LCIRLEESQGS---HM----L 521  

                   egMrNLqFLriykksfrddgk<-*
                   e  r L + +i  +  +  +k   
  gi|4689223   522 EQCRHLSY-SIGFN--GEFKK    539  

gi|14028983|gb|AAK52524.1|AC079128_7: domain 1 of 1, from 167 to 570: score -150.7, E = 6.8e-05
                   *->rDFddlVGiEaHlekmksLLcL...dskdeVrMVGIwGPaGIGKTTI
                       D  dlVGi+   e++   L  +++ sk++ +++ I G  G GKTT 
  gi|1402898   167    IDATDLVGIDHAREELIKTLTEgedSSKQQLKIISIVGFGGPGKTTL 213  

                   ARALfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsy
                   ARA + ++       +F  saF++ +r                ++D +  
  gi|1402898   214 ARAVHEKIE-----AQFDCSAFVSVSR----------------NPDVR-M 241  

                   GmKLhLQeqfLSkI....LnqkDi.kIhdHLGvieERLkdqKVLIiLDDV
                    +K  L++  L k++  ++n    ++I      ++E L+d++ +Ii+DD+
  gi|1402898   242 IFKKMLHQ--LDKVkyanINESSRdEIQ-LIDELREFLQDKRYFIIIDDL 288  

                   DdleQLd....ALAketqWFGpGSRIIVTTeDkqLLkaHg.Inht.IYeV
                    d  + d  + A  k+      GSR I+TT +    ka  + n+  IY+ 
  gi|1402898   289 WDERVWDyikcAFPKDN----LGSRLIITTRNVNVSKACCsANNDiIYKM 334  

                   gfPSkeeALqIFCrsAFgQnsPp.dGF....eeLeAreVtkLaGnLPLGL
                   +  S+++  + F    +++ +P+++G++ + ee  ++e+ k +G  PL+ 
  gi|1402898   335 KPLSEDDSKKLF----YKRIFPHgNGCpcelEEV-SNEILKKCGGVPLAI 379  

                   rVlGSsLRG...kskeeWedmLpRLrtsf..gnsLDgkIekvLrvsYDgL
                       S L  ++  +k+ W  +   +  ++++g    ++ +k+L +sY +L
  gi|1402898   380 ITIASLLANkelQTKDQWFTLHNSIGRGLteGRNV-EDMQKILSFSYYDL 428  

                   hekDqaLFLhIACfFN.gekv..dyVkalLadsnnLD........VrqG.
                    ++ ++  L+  +f  ++e++++ ++  ++a+  ++ +++++++  +qG+
  gi|1402898   429 PSHLKSCLLCLSVFPEdYEIRrnRLIWRWIAEG-FVQqtqnggslFEQGe 477  

                   ..LkvLadKSLIh...isplgnedkvdgtieMHnLLqqLGReAIVrkQsi
                   + ++ L+++S I++ +i+ +g++    + ++ H++   L       +Q  
  gi|1402898   478 nyFNELVNRSMIQpidIDAEGRA----KACRVHDMVLDLICH-MSSQQN- 521  

                   dhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtseieeelnIse
                            F + +++I ++   ++ ++          t+++      + 
  gi|1402898   522 ---------FITVFNDIGNI--TCSRNK----------TCGLI---KCDR 547  

                   kAFegMrNLqFLriykksfrddgk<-*
                      + + N q  r  ++ +++ ++   
  gi|1402898   548 GIYKSLENWQH-RGACSGEICGQH    570  

gi|13897752|gb|AAK48437.1|AF255461_1: domain 1 of 1, from 1 to 166: score -152.8, E = 8.7e-05
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                +V           GKT  ARA
  gi|1389775     1    -------------------------GGV-----------GKTALARA 11   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++ +      ++F+  +F en+r      e  S+         ++    
  gi|1389775    12 VYNSIA-----DQFEGLCFLENVR------EASSK---------HG---L 38   

                   LhLQeqfLSkILnqkDikIh....dHLGvieERLkdqKVLIiLDDVDdle
                   LhLQ  +LS+  +   ik  + +++    i+ RL+++KVL+iLDDVD+ e
  gi|1389775    39 LHLQSTLLSETVGE--IKLTsvkkG-ISIIQHRLQQKKVLLILDDVDKEE 85   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   QL ALA+  +WFG GSR+I+TT DkqLLk+Hg++ t YeV+         
  gi|1389775    86 QLQALAGRPHWFGLGSRVIITTRDKQLLKSHGVERT-YEVK--------- 125  

                   IFCrsAFgQnsPpdGFeeL.eAreVtkLaGnLPLGLrVlGSsLRGkskee
                                    eL+e                             
  gi|1389775   126 -----------------ELnE----------------------------- 129  

                   WedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgek
                    e++L  L                           +a        F  e+
  gi|1389775   130 -ENALELLTW-------------------------KA--------FKFEN 145  

                   vdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLL
                                                 ++p                 
  gi|1389775   146 ------------------------------FDP----------------- 148  

                   qqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIs
                               s                            +        
  gi|1389775   149 ------------SY---------------------------K-------- 151  

                   lDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                         + +ln                +     +  +    
  gi|1389775   152 ------D-VLNL--------------AVTYA--SGLPL    166  

gi|13897760|gb|AAK48441.1|AF255465_1: domain 1 of 1, from 1 to 166: score -152.8, E = 8.7e-05
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                +V           GKTT ARA
  gi|1389776     1    -------------------------GGV-----------GKTTLARA 11   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++ +      ++F+  +F + +r                +   ++    
  gi|1389776    12 VYNSIA-----DQFEGLCFLDGVR---------------ENAVKHG---L 38   

                   LhLQeqfLSkILnqkDikIh....dHLGvieERLkdqKVLIiLDDVDdle
                    hLQe++LS+  +   ik  + +++    i+ RL+++KVL+iLDDVD+ e
  gi|1389776    39 VHLQEMLLSETVGE--IKLTsvkkG-ISIIQHRLQQKKVLLILDDVDKEE 85   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   QL ALA+  +WFG GSR+I+TT DkqLLk+Hg++ t YeV+         
  gi|1389776    86 QLQALAGRPHWFGLGSRVIITTRDKQLLKSHGVERT-YEVK--------- 125  

                   IFCrsAFgQnsPpdGFeeL.eAreVtkLaGnLPLGLrVlGSsLRGkskee
                                    eL+e                             
  gi|1389776   126 -----------------ELnE----------------------------- 129  

                   WedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgek
                    e++L  L                           +a        F  e+
  gi|1389776   130 -ENALELLTW-------------------------KA--------FKFEN 145  

                   vdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLL
                                                 ++p                 
  gi|1389776   146 ------------------------------FDP----------------- 148  

                   qqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIs
                               s                            +        
  gi|1389776   149 ------------SY---------------------------K-------- 151  

                   lDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                         + +ln                +     +  +    
  gi|1389776   152 ------D-VLNL--------------AVTYA--SGLPL    166  

gi|6456755|gb|AAF09256.1|AF202179_1: domain 1 of 1, from 150 to 526: score -153.2, E = 9.2e-05
                   *->rDFddlVGiEaHlekmksLLcLd...skdeVrMVGIwGPaGIGKTTI
                         +++VG ++  ++ ++L +L ++ s  e + + I G  GIGKTT 
  gi|6456755   150    ---NNMVGRDD--QRKQLLEDLTrsyS-GEPKVIPIVGMGGIGKTTL 190  

                   ARALfsqLSerhFq.ssFqlsaFmenlrgsyskeeigSg.etrpaglDeY
                   A+  ++  S       +F  +a  + ++  + k+ei  g   +++  D++
  gi|6456755   191 AKEVYNDES----IlCRFDVHAWAT-ISQQHNKKEILLGlLHSTIKMDDR 235  

                   syGmKLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdl
                                 k+++    +  d    ++  Lk ++ LI+LDD+   
  gi|6456755   236 V-------------KMIGEA--ELAD---MLQKSLKRKRYLIVLDDIWSC 267  

                   eQLdALAketqWFG....pGSRIIVTTeDkqLLkaHgInhtI.YeVgfPS
                   e+ d   +  ++F ++++ GSRI  TT + +     g+++ ++   +f  
  gi|6456755   268 EVWD---GVRRCFPtednAGSRILLTTRNDEVACYAGVEN-FsLRMSFMD 313  

                   keeALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLR.
                   ++e    F   AF     p+ Fe    ++++  +  LPL   V+   L++
  gi|6456755   314 QDESWSLFKSAAFSSEALPYEFETV-GKQIADECHGLPLTIVVVAGLLKs 362  

                   GkskeeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIAC
                    ++ e+W+ +    ++ + n  D++   vL  sYD L +  +   Lh  +
  gi|6456755   363 KRTIEDWKTVAKDVKSFVTNDPDERCSRVLGLSYDHLTSDLKTCLLHFGI 412  

                   fFNgekv...dyVkalLadsnnL........DVrqGLkvLadKSLIhisp
                   f   ++++ +++  ++ a+  +L+ +++ ++ V+  L+ L+d++L+ +s 
  gi|6456755   413 FPEDSDIpvkNLMRSWMAEG-FLklendlegEVEKCLQELVDRCLVLVSK 461  

                   lgned.kvdgtieMHnLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIc
                    +++ +k  + ++ H+L   L     V+++ i         F ++     
  gi|6456755   462 RSRDGtK-IRSCKVHDLIYDLCVR-EVQRENI---------FIMN----- 495  

                   dVLtdnTGtgtrsVlGIslDtseiee.elnIsekAFegMrNLqFLriykk
                                   I lD+s  e++ l++      +M  ++  r+   
  gi|6456755   496 ---------D------IVLDVSYPECsYLCM-----YKMQPFK--RVT-- 521  

                   sfrddgk<-*
                     +d+ +   
  gi|6456755   522 --GDEIN    526  

gi|7489066|pir||T06404: domain 1 of 1, from 165 to 505: score -153.3, E = 9.2e-05
                   *->rDFddlVGiEaHlekmksLLcLdskdeV.....rMVGIwGPaGIGKT
                       D  d+ G    +e +    +L s +++++++   V I G  G GKT
  gi|7489066   165    IDEPDIFGRQSEIEDLID--RLLS-EGAsgknlTVVPIVGMGGLGKT 208  

                   TIARALfsqLSerhFq.ssFqlsaFmenlrgsysk........eeigSge
                   T A+A ++  S     ++ F l+a    +++ y   + +++  +eigS  
  gi|7489066   209 TLAKAVYNDES----VkNHFDLKAWFC-VSEAYNAfritkgllQEIGS-- 251  

                   trpaglDeYsyGmKLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVL
                      + l + +               Lnq  +++      ++ERLk +K L
  gi|7489066   252 ---IDLVDDN---------------LNQ--LQVK-----LKERLKEKKFL 276  

                   IiLDDV........DdleQLdALAketqWFG.pGSRIIVTTeD..kqLLk
                   I+LDDV +++ ++ D l    + +      G+ GS IIVTT  ++  L++
  gi|7489066   277 IVLDDVwndnynewDELR--NVFVQ-----GdIGSKIIVTTRKdsVALMM 319  

                   aHg.InhtIYeVgfPSkeeALqIFCrsAFgQnsPp..dGFeeLeAreVtk
                     ++I       g  S+e     F r+AF  + P ++   ee   r+++ 
  gi|7489066   320 GNEqISM-----GNLSTEASWSLFQRHAFENMDPMghSELEEV-GRQIAA 363  

                   LaGnLPLGLrVlGSsLRGksk.eeWedmLp....RLrtsfgnsLDgkIek
                    +  LPL+L+ l   LR ks+ eeW+ +L+++  +Lr       D +I  
  gi|7489066   364 KCKGLPLALKTLAGMLRSKSEvEEWKCILRseiwELR-------DNDILP 406  

                   vLrvsYDgLhekDqaLFLhIACf.....FNgekvdyVkalLadsnnLDVr
                    L  sY++L  + +  F   A+f+++ +F++e    ++ ++a+       
  gi|7489066   407 ALMLSYNDLPAHLKRCFSFCAIFpkdypFRKEQ--VIHLWIANG------ 448  

                   qGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGReAIVrkQsidhd
                             L+ +++                 q LG +    + s    
  gi|7489066   449 ----------LVPVED--------------EIIQDLGNQ-FFLELS---- 469  

                   ePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtseieeelnIsekAF
                             ++   +   + +                i+ el+      
  gi|7489066   470 ----------SRSLFERVPNPSEGN-------------IK-ELFL----- 490  

                   egMrNLqFLriykksfrddgk<-*
                     M++L    +++  +  + k   
  gi|7489066   491 --MHDL----VNDLAQLASSK    505  

gi|4164087|gb|AAD08712.1|: domain 1 of 1, from 1 to 165: score -153.9, E = 1e-04
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                +            GKTTIARA
  gi|4164087     1    -------------------------GG------------GKTTIARA 10   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    f+ LS      +F+  +F+e +++++              +  +s    
  gi|4164087    11 IFDTLS-----YQFEAACFIEDVKENR--------------FGMHS---- 37   

                   LhLQeqfLSkILnqkDikIhd.....HLGvieERLkdqKVLIiLDDVDdl
                     LQ+ +LS++L+ kD  ++++++++H   i  RL  +KVL++LDD+D+ 
  gi|4164087    38 --LQNILLSELLREKDSYVNNkedgkHM--IARRLPFKKVLVVLDDIDHR 83   

                   eQLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeAL
                   + Ld LA+  +WFG GSRII TT Dk+L    ++   +YeV+   + +A 
  gi|4164087    84 DHLDYLAGNPSWFGDGSRIITTTRDKHLIGKNDV---VYEVSTLVDRHAI 130  

                   qIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskee
                   + F ++AF++  P + Fe+L + eV+++a  LP                 
  gi|4164087   131 KLFNQYAFKEEVPDECFEKL-SLEVIRHAKGLP----------------- 162  

                   WedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgek
                                                                     
  gi|4164087     - -------------------------------------------------- -    

                   vdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLL
                                                  sp                 
  gi|4164087   163 -------------------------------SP----------------- 164  

                   qqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIs
                                                            +        
  gi|4164087   165 -----------------------------------------S-------- 165  

                   lDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                            
  gi|4164087     - --------------------------------------    -    

gi|11357259|pir||T48468: domain 1 of 1, from 173 to 501: score -154.8, E = 0.00011
                   *->rDFddl.VGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIAR
                       D  dl+VG++   +k k +L     d+ r +GI+G +G GKTT A+
  gi|1135725   173    TDGADLgVGLDLGKRKVKEMLFKSI-DGERLIGISGMSGSGKTTLAK 218  

                   ALfs..qLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsy
                    L  ++          F  ++    ++             +p +l e   
  gi|1135725   219 ELARdeEVR-----GHFGNKVLFLTVS------------QSP-NLEE--- 247  

                   GmKLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQ
                    +  h    + S           +    ++  L   + L+iLDDV   e 
  gi|1135725   248 -LRAHIWGFLTSY----------E--AGVGATLPESRKLVILDDVWTRES 284  

                   LdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqI
                   Ld L  e     pG    V+   k  L   ++  t Y V++  ++eA   
  gi|1135725   285 LDQLMFENI---PGTTTLVVSRSK--LADSRV--T-YDVELLNEHEATAL 326  

                   FCrsAFgQnsPpdGF.eeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                   FC+s F Q+  p GF++ L +++V+  +  LPL L+V G sL+ + +++W
  gi|1135725   327 FCLSVFNQKLVPSGFsQSL-VKQVVGECKGLPLSLKVIGASLKERPEKYW 375  

                   edmLpRL.......rtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIAC
                   e +  RL+++++ ++t    +    Ie +L    + L+ k  + FL    
  gi|1135725   376 EGAVERLsrgepadET-HESRVFAQIEATL----ENLDPKTRDCFLVLGA 420  

                   fFN.gekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgt
                   f  ++++             LDV           LI++            
  gi|1135725   421 FPEdKKI------------PLDV-----------LINVL----------- 436  

                   ieMHnLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgt
                   +e H+L    +   ++    +       R  L+  +        +   g 
  gi|1135725   437 VELHDLEDATAFA-VIVDLAN-------RNLLTLVK--------DPRFG- 469  

                   rsVlGIslDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                         +  ts  +  ++ + ++++       Lr  ++  ++ ++   
  gi|1135725   470 ------HMYTSYYD-IFVTQHDVLRDVA----LRLSNH--GKVNN    501  

gi|7649326|emb|CAB88870.1|: domain 1 of 1, from 1 to 170: score -155.0, E = 0.00011
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                ++           GKTT A+A
  gi|7649326     1    -------------------------GGM-----------GKTTLAKA 11   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L++++      ++F+  +F  n+r                 ++ Y+    
  gi|7649326    12 LYNKIA-----DDFEGCCFLPNIR---------------EASNQYG--GL 39   

                   LhLQeqfLSkILnqkDikIhdHL....GvieERLkdqKVLIiLDDVDdle
                    +LQ+++L +IL  + ik++ +L+++   i++RL  +K L+iLDDVD  e
  gi|7649326    40 VQLQRELLREILVDDSIKVS-NLprgvTIIRNRLYSKKILLILDDVDTRE 88   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   QL AL++   WFG+GS +I TT ++qLL  Hg +  +  V     +eAL+
  gi|7649326    89 QLQALVGGHDWFGHGSKVIATTRNRQLLVTHGFDK-MQSVVGLDYDEALE 137  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    F  + F+ + P +++ eL +++ +  +  LP                  
  gi|7649326   138 LFSWHCFRNSHPLNDYLEL-SKRAVDYCKGLP------------------ 168  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                                                                     
  gi|7649326     - -------------------------------------------------- -    

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                                                                     
  gi|7649326   169 ------------------------------F------------------- 169  

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                        A                                            
  gi|7649326   170 -----A-------------------------------------------- 170  

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                           
  gi|7649326     - -------------------------------------    -    

gi|5911745|emb|CAB55838.1|: domain 1 of 1, from 140 to 486: score -155.4, E = 0.00012
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         + +VG E   e+m   L      e   V I G  GIGKTT A  
  gi|5911745   140    ---NIMVGRENEFEMMLDQLARGG-RELEVVSIVGMGGIGKTTLAAK 182  

                   Lfs..qLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyG
                   L+s++ +      s+F  +a  + ++                   eY   
  gi|5911745   183 LYSdpYIM-----SRFDIRAKAT-VS------------------QEYC-- 206  

                   mKLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDV......
                   +   L   +LS   +  D +  d+L   +  Lk ++ L+++DD+ +++  
  gi|5911745   207 VRNVLLG-LLSLTSDEPDYQLADQL---QKHLKGRRYLVVIDDIwtteaw 252  

                   DdleQLdALAketqWFGpGSRIIVTTeDkqLLka.......HgInhtIYe
                   Dd+++     +      +GSRI  TT + +  +  ++++++H   +    
  gi|5911745   253 DDIKLCFPDCD------NGSRILLTTRNVEVAEYassgkppHHMRLM--- 293  

                   VgfPSkeeALqIFCrsAFgQnsPp.dGFeeLeAreVtkLaGnLPLGLrVl
                         +e    ++   F +   ++  Fe++  ++++  +G LPL+    
  gi|5911745   294 ----NFDESWNLLHKKIFEKEGSYsPEFENI-GKQIALKCGGLPLAITLI 338  

                   GSsLRG..kskeeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqa
                      L   +k+ +eW ++    r+ +   L  k + vL  sY  L ++ + 
  gi|5911745   339 AGLLSKisKTLDEWQNVAENVRSVVSTDLEAKCMRVLALSYHHLPSHLKP 388  

                   LFLhIACfFN.gek..vdyVkalLadsnnLDVrqG..........LkvLa
                    FL+ A+f  ++++   ++V+ +  +  +L+ + G++ ++  ++  + L+
  gi|5911745   389 CFLYFAIFAEdERIyvNKLVELWAVEG-FLNEEEGksieevaetcINELV 437  

                   dKSLIhisplgnedkvdgtieMHnLLqqLGReAIVrkQsidhdePgKRqF
                   d+SLI+i +                        +    s           
  gi|5911745   438 DRSLISIHN------------------------V----S----------- 448  

                   LvDaeeIcdVLtdnTGtgtrsVlGIslDtseieeelnIsekAFegMrNLq
                    +D e            g          ++ + +el+  e      rN  
  gi|5911745   449 -FDGE--------TQRCG----------MHDVTRELCLREA-----RNMN 474  

                   FLriykksfrddgk<-*
                   F ++ +   ++d++   
  gi|5911745   475 FVNVIRG--KSDQN    486  

gi|7489237|pir||T07767: domain 1 of 1, from 1 to 154: score -155.5, E = 0.00012
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                                  AR+
  gi|7489237     1    -----------------------L--------------------ARV 4    

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++ +      s+Fq  +F   +r                   ++s  +K
  gi|7489237     5 IYDNIR-----SQFQGACFLHEVR-------------------DRS--AK 28   

                   L...hLQeqfLSkILnqkDikIhdHLGvi...eERLkdqKVLIiLDDVDd
                    + ++LQe +LS+IL  k ++I+d +  ++ +++RL+ +KVL++LDDVD+
  gi|7489237    29 QgleRLQEILLSEILVVKKLRINDSFEGAnmqKQRLQYKKVLLVLDDVDH 78   

                   leQLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeA
                   ++QL ALA+e +WFG GSRII+TT+Dk+LL  ++ +  IY  +   ++e 
  gi|7489237    79 IDQLNALAGEREWFGDGSRIIITTKDKHLLVKYETEK-IYRMKTLNNYES 127  

                   LqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkske
                   Lq F ++AF++n P   Fe+L                             
  gi|7489237   128 LQLFKQHAFKKNRPTKEFEDL----------------------------- 148  

                   eWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNge
                                                                     
  gi|7489237     - -------------------------------------------------- -    

                   kvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnL
                              s                                      
  gi|7489237   149 -----------S-------------------------------------- 149  

                   LqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGI
                          A    Q i                           +       
  gi|7489237   150 -------A----QVI---------------------------K------- 154  

                   slDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                             
  gi|7489237     - ---------------------------------------    -    

gi|3309619|gb|AAC26125.1|: domain 1 of 1, from 157 to 535: score -156.4, E = 0.00013
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                           +VG +  l k     cL   d V +VG +G  G+GKTT    
  gi|3309619   157    -----IVGQDSMLDKVWN--CLME-DKVWIVGLYGMGGVGKTTLLTQ 195  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                     +++S  +    F   + +  ++                +   +    +
  gi|3309619   196 INNKFS--KLGGGFDVVIWVVVSK----------------NATVHK--IQ 225  

                   LhLQeq..fLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQL
                    +  e+ ++  k  + k+   +  L  i + L+ +K  + LDD+   + L
  gi|3309619   226 KSIGEKlgLVGKNWDEKNKNQR-AL-DIHNVLRRKKFVLLLDDIWEKVEL 273  

                   dAL.....AketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkee
                   ++++ + + +e     +G  +  TT  k+     g+++            
  gi|3309619   274 KVIgvpypSGE-----NGCKVAFTTHSKEVCGRMGVDNP----------- 307  

                   ALqIFCr...sAF.......gQnsP..pdGFeeLeAreVtkLaGnLPLGL
                    ++I C++++ A++  +++ g+n+ +++ +  +L Ar+V + +  LPL+L
  gi|3309619   308 -MEISCLdtgNAWdllkkkvGENTLgsHPDIPQL-ARKVSEKCCGLPLAL 355  

                   rVlGSsLR.GkskeeWedmLpRLrtsf.gnsLDgkIekvLrvsYDgLhek
                   +V G  +   ++ +eW  +   L +  +  +  ++I  +L+ sYD+L+ +
  gi|3309619   356 NVIGETMSfKRTIQEWRHATEVLTSATdFSGMEDEILPILKYSYDSLNGE 405  

                   .DqaLFLhIACf...FNgekvdyVkalLadsnnLDVrqG...........
                   + ++ FL+   f+++F  +k  +++ ++ +  +   +qG+++  +++ + 
  gi|3309619   406 dAKSCFLYCSLFpedFEIRKEMLIEYWICEG-FIKEKQGrekafnqgydi 454  

                   LkvLadKSLIhisplgnedkvdgtieMHnLLqqLGReAIVrkQsidhdeP
                   L +L+  SL     ++     ++ + MH++ ++++   I     +   + 
  gi|3309619   455 LGTLVRSSLLLEGAKD-----KDVVSMHDMVREMALW-I-----F--SDL 491  

                   gKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslD.tseieeelnIsekAFe
                   gK++            + ++        GI lD++ e+e     + +A +
  gi|3309619   492 GKHK------------ERCIVQA-----GIGLDeLPEVE-----NWRAVK 519  

                   gMrNLqFLriykksfrddgk<-*
                   +M+    L  ++  ++   +   
  gi|3309619   520 RMS----LMNNNFEKILGSP    535  

gi|11611778|gb|AAG39059.1|: domain 1 of 1, from 1 to 167: score -156.7, E = 0.00014
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                ++      G  G+GKTT AR 
  gi|1161177     1    --------------------------GR------GIGGVGKTTVARK 15   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    f++ S     ++Fq s+F  n+r                ++  ++    
  gi|1161177    16 YFDKVS-----HQFQRSCFLANVR---------------EESKKHG---L 42   

                   LhLQeqfLSkILnqkDikIhdHL....GvieERLkdqKVLIiLDDVDdle
                    hLQ+ +LSk+L+ k + I   + ++   i+ RL++ KVLI+ DDVDd +
  gi|1161177    43 MHLQKTLLSKLLKEKSMNIA-SFyegaDMIKRRLCHWKVLIVFDDVDDED 91   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   QL+ L++   WFG GS +I TT ++ LL++H  +   Y V    k +A +
  gi|1161177    92 QLEYLVGNHDWFGGGSIVITTTRNQDLLRSH--DQ-LYSVPVLAKADAIE 138  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    F  +AF + +P   F eL                               
  gi|1161177   139 VFSWHAFQKPTPDKEFLEL------------------------------- 157  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                                                                     
  gi|1161177     - -------------------------------------------------- -    

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                            s              KS +                      
  gi|1161177   158 ---------S--------------KSVVD-Y------------------- 164  

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                        A                                  g         
  gi|1161177   165 -----A---------------------------------KG--------- 167  

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                           
  gi|1161177     - -------------------------------------    -    

gi|625973|pir||A54809: domain 1 of 1, from 155 to 559: score -157.5, E = 0.00015
                   *->rDFddlVGiEaHlekmksLLcLdskdeVr.MVGIwGPaGIGKTTIAR
                            VG     ++m++ L + s++e r+++G++GP G+GKTT   
  gi|625973|   155    -----VVG---NTTMMEQVLEFLSEEEERgIIGVYGPGGVGKTTLMQ 193  

                   ALfsqLSerhFq.ssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyG
                      + L     +++++   + +  +r+ ++        t+   +  +   
  gi|625973|   194 SINNELI---TKgHQYDVLIWVQMSREFGE-------CTIQQAVGAR--- 230  

                   mKLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDV.DdleQ
                   + L++ e+   +      +kI          L++++ L+ LDDV + +++
  gi|625973|   231 LGLSWDEK---ETGENRALKIY-RA------LRQKRFLLLLDDVwEEIDL 270  

                   LdALA....ketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkee
                    ++ +++++ e ++      +  TT    L    g +++   V+f  k++
  gi|625973|   271 EKTGVprpdRENKC-----KVMFTTRSIALCNNMGAEYK-LRVEFLEKKH 314  

                   ALqIFCrsAFgQnsPp.dGFeeLeAreVtkLaGnLPLGLrVlGSsLR.Gk
                   A + FC   ++++   +     L A+ ++  +G LPL+L  lG ++ +++
  gi|625973|   315 AWELFCSKVWRKDLLEsSSIRRL-AEIIVSKCGGLPLALITLGGAMAhRE 363  

                   skeeWe...dmLpRLrtsfgnsLDgkIekvLrvsYDgLhek.DqaLFLhI
                   ++eeW++ +++L R+     ++ +  +   L++sYD L +    + FL+ 
  gi|625973|   364 TEEEWIhasEVLTRFPA-EMKGMNY-VFALLKFSYDNLESDlLRSCFLYC 411  

                   ACfFN.g..ekvdyVkalLadsnnLDVrqGLkv..........LadKSLI
                   A f  +++ e+  +V+ + ++  +L  ++G ++  ++    ++L   +L 
  gi|625973|   412 ALFPEeHsiEIEQLVEYWVGEG-FLTSSHGVNTiykgyfligdLKAACLL 460  

                   hisplgnedkvdgtieMHnLLqqLGReAIVrkQsidhdePgKRqFLvDae
                      +++++      ++MHn  + ++      +Q ++     K  +Lv++ 
  gi|625973|   461 ETGDEKTQ------VKMHNVVRSFALW-MASEQGTY-----KELILVEPS 498  

                   eIcdVLtdnTGtgtrsVlGIslD...tseiee.elnIsekAFegMrNLqF
                         +  +   +r  l Isl ++++  + e+ ++     +    N   
  gi|625973|   499 --MGHTEAPKAENWRQALVISLLdnrIQTLPEkLICPKLTTLMLQQNSSL 546  

                   Lriykksfrddgk<-*
                    +i +  f++ +    
  gi|625973|   547 KKIPTGFFMHMPV    559  

gi|12231681|gb|AAG49214.1|: domain 1 of 1, from 1 to 155: score -157.8, E = 0.00016
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                           L s  ++                   
  gi|1223168     1    ---------------------LAS--AA------------------- 5    

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    +  +S     ++F+ ++   n+r+          e+ ++gl        
  gi|1223168     6 -YAEIS-----HRFEAHCLLQNIRE----------ESNKHGLEK------ 33   

                   LhLQeqfLSkILnqkDik....IhdHLGvieERLkdqKVLIiLDDVDdle
                     LQe+fLS IL+  D+k +++I+     ie RL+++ VL++LDDVDdle
  gi|1223168    34 --LQEKFLSLILKA-DVKvgsgIE-GRSIIERRLRNKNVLVVLDDVDDLE 79   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   QL+ALA+   WFG GSRII+TT+D +LL  H  +  IYeV++ S++eA +
  gi|1223168    80 QLEALAGSHAWFGKGSRIIITTKDEHLLTRHA-DT-IYEVSLLSQDEAVE 127  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    F  +A++++ P +++e+L ++ V+                         
  gi|1223168   128 LFNKHAYRKDKPIEDYEML-SKDVV------------------------- 151  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                                                                     
  gi|1223168     - -------------------------------------------------- -    

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                            s                                        
  gi|1223168   152 ---------S--------------------Y------------------- 153  

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                        A                                  +         
  gi|1223168   154 -----A----------------------------------S--------- 155  

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                           
  gi|1223168     - -------------------------------------    -    

gi|7488663|pir||T08820: domain 1 of 1, from 1 to 169: score -158.4, E = 0.00017
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                +V           GKTTIAR 
  gi|7488663     1    -------------------------GGV-----------GKTTIARE 11   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++++      ++F+  +F +n+r++           +++gl        
  gi|7488663    12 VYNLIA-----DQFEWLCFLDNVRENS----------IKHGLV------- 39   

                   LhLQeqfLSkILnqkDik...IhdHLGvieERLkdqKVLIiLDDVDdleQ
                    hLQ+ +LSk ++   ik +++h+    i+ R   +KVL++ DDVDd +Q
  gi|7488663    40 -HLQKTLLSKTIGESSIKlgsVHEGIPIIKHRFLLKKVLLVVDDVDDPDQ 88   

                   LdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqI
                   L A+++ t WFG+ S +I+TT Dk+LL  Hg+  t YeV+   keeAL+ 
  gi|7488663    89 LQAIVGGTDWFGSASSVIITTRDKHLLTCHGVTST-YEVDGLNKEEALKL 137  

                   FCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWe
                   +   AF+ +     ++ +  ++V++ a  LPL                  
  gi|7488663   138 LSGTAFKIDKVDPCYMRI-LNRVVTYASGLPL------------------ 168  

                   dmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvd
                                                                     
  gi|7488663     - -------------------------------------------------- -    

                   yVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqq
                                                                     
  gi|7488663     - -------------------------------------------------- -    

                   LGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslD
                       A                                             
  gi|7488663   169 ----A--------------------------------------------- 169  

                   tseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                          
  gi|7488663     - ------------------------------------    -    

gi|10176752|dbj|BAB09983.1|: domain 1 of 1, from 155 to 527: score -158.4, E = 0.00017
                   *->rDFddlVGiEaHlekm.ksLLcLdskdeVrMVGIwGPaGIGKTTIAR
                          ++VG Ea  e   +s+  ++   +V   GI+G  G+GKTT   
  gi|1017675   155    ----EIVGQEAIVESTwNSM--MEV--GVGLLGIYGMGGVGKTT--- 190  

                   ALfsqLSerhFq...ssFqlsaFmenlrgsysk...eeigSgetrpaglD
                    L sq+   +F + +++F   + +  ++    k+ +e+ig +      lD
  gi|1017675   191 -LLSQIN-NKFRtvsNDFDIAIWVVVSKNPTVKriqEDIGKR------LD 232  

                   eYsyGmKLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDV.
                    Y+      ++++           +I     +i+  L ++K  + LDD  
  gi|1017675   233 LYN----EGWEQK--------TENEIA---STIKRSLENKKYMLLLDDMw 267  

                   DdleQLdALAketqWFG......pGSRIIVTTeDkqLLkaHgInhtIYeV
                    +++    LA+     G + ++++GS I  T    +     g++ +  eV
  gi|1017675   268 TKVD----LAN----IGipvpkrNGSKIAFTSRSNEVCGKMGVDKE-IEV 308  

                   gfPSkeeALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGS
                        ++A   F r        +    e  A+ +++ +  LPL+L+V G 
  gi|1017675   309 TCLMWDDAWDLFTRNMKETLESHPKIPEV-AKSIARKCNGLPLALNVIGE 357  

                   sLRG.kskeeWedmLpRLrtsfgnsLDgkIekvLrvsYDgL.hekDqaLF
                    + ++ks eeW d+   +      ++  +I ++L++sYD+L++ek ++ F
  gi|1017675   358 TMARkKSIEEWHDAVGVFS-----GIEADILSILKFSYDDLkCEKTKSCF 402  

                   LhIACfFN.gek..vdyVkalLadsnnLDVrqGLkvLadKSLIhisplgn
                   L  A f  ++e++++d+++ + +            +L  K +        
  gi|1017675   403 LFSALFPEdYEIgkDDLIEYWVGQG---------IILGSKGINYKG---- 439  

                   e.............d.kvdgtieMHnLLqqLGReAIVrk.....Qsidhd
                   ++  ++ ++    +++++++ ++MH+  ++++   I    ++++Q++   
  gi|1017675   440 YtiigtltrayllkEsETKEKVKMHDVVREMALW-ISSGcgdqkQKN--- 485  

                   ePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtseieeelnIsekAF
                                   V + n   +         D+ +ie     + kA 
  gi|1017675   486 --------------VLVVEANAQLR---------DIPKIE-----DQKAV 507  

                   egMrNLqFLriykksfrddgk<-*
                   ++M+ L +  i +  ++ + +   
  gi|1017675   508 RRMS-LIYNQIEEACESLHCP    527  

gi|8809611|dbj|BAA97162.1|: domain 1 of 1, from 2 to 365: score -158.7, E = 0.00018
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                        L  L+  de+r++GI+G  G GKT  A+ 
  gi|8809611     2    ------------------LFNLN--DEARIIGISGMIGSGKTILAKE 28   

                   Lfs..qLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyG
                   L  ++          F  ++    ++             +p +l e    
  gi|8809611    29 LARdeEVR-----GHFANRVLFLTVS------------QSP-NLEELR-- 58   

                   mKLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQL
                      +L + fL   +++   +      +++E   + + L+iLDDV   e L
  gi|8809611    59 ---SLIRDFL---TGH---EAG-FGTALPESVGHTRKLVILDDVRTRESL 98   

                   dALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIF
                   d L   +    pG    V+ + k      +   t Y V++  +++A   F
  gi|8809611    99 DQLMFNI----PGTTTLVVSQSKLV----DPRTT-YDVELLNEHDATSLF 139  

                   CrsAFgQnsPpdGFee.LeAreVtkLaGnLPLGLrVlGSsLRGkskeeWe
                   C+sAF Q+s p GF ++L +++V+     LPL L+VlG sL  + + +W 
  gi|8809611   140 CLSAFNQKSVPSGFSKsL-VKQVVGESKGLPLSLKVLGASLNDRPETYWA 188  

                   dmLpRLrtsfgnsLDg........kIekvLrvsYDgLhekDqaLFLhIAC
                    +  RL    g+  D++++++    Ie +L    + L+ k ++ FL    
  gi|8809611   189 IAVERLSR--GEPVDEtheskvfaQIEATL----ENLDPKTKECFLDMGA 232  

                   fFNgek..vdyVkalLadsnnLDVrqGLkvLadKSLIhisplgne.....
                   f  g+k +vd +  +L +  +L     + vL+d  L + + l+  ++++ 
  gi|8809611   233 FPEGKKipVDVLINMLVKIHDLEDAAAFDVLVD--LANRNLLTLVkdptf 280  

                   ....dkv.dgtieMHnLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIc
                      +    d ++  H+ L+ ++      + ++     +  + L+  +e  
  gi|8809611   281 vamgTSYyDIFVTQHDVLRDVALH-LTNRGKV----SRRDRLLMPKRETM 325  

                   dVLtdnTGtgtrsVlGIslDtseieeelnIsekAFegMrNLqFLriykks
                     L  +   +       s D   + ++++I+      M      +++++ 
  gi|8809611   326 --LPSEWE-R-------SNDEPYNARVVSIHTGEMTEMD-----WFDMD- 359  

                   frddgk<-*
                   f +++    
  gi|8809611   360 FPKAEV    365  

gi|7488669|pir||T08835: domain 1 of 1, from 1 to 170: score -159.4, E = 0.00019
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                +V           GKTT AR+
  gi|7488669     1    -------------------------GGV-----------GKTTLARV 11   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    f ++      ++F  s+F en+r++              + D       
  gi|7488669    12 VFKKIR-----NKFDISCFLENVREIS------------QNCDGM----- 39   

                   LhLQeqfLSkILnqkDikIhdHL....GvieERLkdqKVLIiLDDVDdle
                   L+LQ ++LS + ++kD+kI  +L++++  i+  L +  VL++LDDV+d+ 
  gi|7488669    40 LSLQGKLLSHM-KMKDLKIQ-NLdegkSIIGGILFNNNVLLVLDDVNDIR 87   

                   QLdAL.AketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeAL
                   QL+  ++++ +W GpGSRII++T D + L++Hg     Y+ ++   +e L
  gi|7488669    88 QLENFsVNDQKWLGPGSRIIIITRDMEVLRSHGTVES-YKIDLLNSGESL 136  

                   qIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskee
                   q F + AF++++P +   +L ++  +  aG LPL                
  gi|7488669   137 QLFSQKAFKRDQPLEHILQL-SKVAVQQAGGLPL---------------- 169  

                   WedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgek
                                                                     
  gi|7488669     - -------------------------------------------------- -    

                   vdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLL
                                                                     
  gi|7488669     - -------------------------------------------------- -    

                   qqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIs
                         A                                           
  gi|7488669   170 ------A------------------------------------------- 170  

                   lDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                            
  gi|7488669     - --------------------------------------    -    

gi|13377497|gb|AAK20736.1|: domain 1 of 1, from 164 to 566: score -159.6, E = 0.00019
                   *->rDFddlVGiEaHlekmksLL.....cLd..skdeVrMVGIwGPaGIG
                      rD +dlVGiE   e++ + L++++++L+++s + V M  +wG +G+G
  gi|1337749   164    RD-EDLVGIEENKERLIQWLtrggdDLErsS-NKVTM--VWGMPGVG 206  

                   KTTIARALfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglD
                   KTT     ++        ++F   a ++ +++sy          r+    
  gi|1337749   207 KTTLVDHVYNTVK-----ENFDAAAWVT-VSESY----------RI---E 237  

                   eYsyGmKLhLQeqfLSkILnqkDikIhdHLGv.ieERLkdqKVLIiLDDV
                   +    +      qf S   +  +i+ +  L  +i + L+ ++  ++LDDV
  gi|1337749   238 D----LLKKIAAQF-SITVDVANIEMR-GLAKsIHNYLQGKRYILVLDDV 281  

                   DdleQLdALAketqWFGpGS....RIIVTTeDkqLLk....aHgInhtIY
                    d      L  +++   p S++++R++ T      L ++++a++I ++  
  gi|1337749   282 WDER----LWSDIRDVFPTSnstgRVVMTSRKETVLAtresAYEIQLK-- 325  

                   eVgfPSkeeALqIFCrsAFg...QnsPpdGFeeLeAreVtkLaGnLPLGL
                          ++    FC  AF + + +  p   ++L A++++  +  LP + 
  gi|1337749   326 PLQ---AHHSWVLFCKGAFEdadDKECPLELQKL-AWKFIAKCQGLPIAI 371  

                   rVlGSsLRGk..skeeWedmLpRLrtsfgnsLDgkIek....vLrvsYDg
                      G  L +k ++  eWed+ + L +     L  ++  + + +L+vs ++
  gi|1337749   372 TCIGRLLSRKlpTSAEWEDVYRGLDS----QLVKDVIPdarlILKVSLED 417  

                   LhekDqaLFLhIA.....CfFNgekvdyVkalLadsnnL..........D
                   L    +  FLh A ++++C+   +k  +  +++ +  + ++++++++ + 
  gi|1337749   418 LPFDLKNCFLHCAlspedCILKRRK--TMRQWITAG-FItetdesktleE 464  

                   VrqG.LkvLadKSLIhisplgned.kvdgtieMHnLLqqLGReAIVrkQs
                   V  G L  L+++SL ++  ++n+ ++  + ++MH+  + L+      +++
  gi|1337749   465 VAEGyLVELVNRSLLQVV-ERNYAgR-LKECRMHDVIRLLALN-KAKEEC 511  

                   idhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslD...tseieeel
                   ++                 +V +   Gtg        +  ++ ++i+ +l
  gi|1337749   512 FG-----------------NVYNGSGGTG-------VFSiegARRIS-VL 536  

                   ..nIsekAFegMrNLqFLriykksfrddgk<-*
                   ++nI+  ++ g + L+ L++++++ + d     
  gi|1337749   537 ggNIEQLSLSGATQLRALHVFESYIDIDLL    566  

gi|5669782|gb|AAD46471.1|AF108010_1: domain 1 of 1, from 134 to 548: score -159.7, E = 0.0002
                   *->rDFddlVGiEaHlekmks.LLcLdskdeVrMVGIwGPaGIGKTTIAR
                         ++lVG +     +++ LL +d    V  +  +G  G GKT    
  gi|5669782   134    ---EELVGVDENRGQLEQwLLPMDLLHYV-VIVLYGMGGLGKT---- 172  

                   ALfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGm
                   +L    + r+  ++F  +a ++ ++      +++S    +   D     +
  gi|5669782   173 VLAANVY-RKEREKFDCHAWVS-IS------QTYS---TK---DV----L 204  

                   KLhLQeqf......LSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVD
                   K +L  ++ +++++    +n  +++I+d   ++   L+d+K LIiLDDV 
  gi|5669782   205 K-CLITELyrdrqdIPDHIN--NMRINDLXHAVSAXLNDKKYLIILDDVW 251  

                   dle....QLdALAketqWFGpGSRIIVTTeDkqL..LkaHg..InhtIYe
                     e  +++  AL+   +     SR ++TT   +   L + ++   +t   
  gi|5669782   252 SPEafgdLFGALVH-NH---MQSRLVITTRQGKVcaLASPEriLALT--- 294  

                   VgfPSkeeALqIFCrsAFgQns...PpdGFeeLeAreVtkLaGnLPLGLr
                     +P ++ AL  FC  AF  + +++ p  F+ L ++e++k +  LPL+L 
  gi|5669782   295 -ALP-EDKALDLFCKKAFPSTHnhkCPAEFNPL-SEEIVKKCRGLPLALV 341  

                   VlGSsLR..GkskeeWedmLpRLrtsfgn..sLDgkIekvLrvsYDgLhe
                    +GS LR + ks eeW ++   L  ++ n+++L  +I ++L  sY  L  
  gi|5669782   342 SVGSLLRvrEKSVEEWRKINDQLSWELINnpRL-HDIRNILHLSYIYLPA 390  

                   kDqaLFLhIACf...FNgekvdyVkalLadsnnLDVrqGLkvLad.....
                   + ++ FL+   f+++   +   +   ++a+  +     G  +L +  ++ 
  gi|5669782   391 HLKSCFLYCSLFpedYIFQRKQLARLWIAEG-FIE-GRGASTLEEvaeey 438  

                   .KSLIhisplgnedkv.dgti...eMHnLLqqLGReAIVrk.........
                    K L+h ++l+  ++++ g+i++ +MH+  ++L+ +  +++   +   ++
  gi|5669782   439 mKELVHRNMLQLVERNsFGRIkkfRMHDIIRELAVD-LCQNvyfgvayde 487  

                   .......QsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDts
                   ++ ++  ++++      R+  v        L  ++             +s
  gi|5669782   488 dkcggylEKVG------RRLVVHK------LKKDIEQA----------IS 515  

                   eieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   +i +  +I   +   M+ L  L++  k++r+ +    
  gi|5669782   516 RIHHLRSI-AVVDNSMPSLTLLSVLSKMSRYMTV    548  

gi|11278007|pir||T45590: domain 1 of 1, from 161 to 516: score -160.2, E = 0.00021
                   *->rDFddlVGiEaHlek.mksLLcLdskdeVrMVGIwGPaGIGKTTIAR
                         +  VG+E+  +  ++ LL+ + k  + ++ I G  G GKT  AR
  gi|1127800   161    ---EVVVGLEDDAKIlLEKLLDYEEK-NRFIISIFGMGGLGKTALAR 203  

                   ALfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGm
                    L++  S r  +++F+ +a  + ++  y+  +i  +  ++ +l   s G 
  gi|1127800   204 KLYN--S-RDVKERFEYRAWTY-VSQEYKTGDILMR--IIRSLGMTS-GE 246  

                   KLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDV......D
                    L   ++f       + +++      +   L  +K L++ DD+ +++  D
  gi|1127800   247 ELEKIRKF-----AEEELEVY-----LYGLLEGKKYLVVVDDIwereawD 286  

                   dleQLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIY..eVgfPSk
                    l+   AL    +    GSR+I+TT  k    a g++  +Y ++  f + 
  gi|1127800   287 SLK--RALPCNHE----GSRVIITTRIKA--VAEGVDGRFYahKLRFLTF 328  

                   eeALqIFCrsAFgQnsPp.dGFeeLeAreVtkLaGnLPLGLrVlGSsLRG
                   ee  + F + AF+  + ++++  +   +e +  +  LPL+  Vl   L +
  gi|1127800   329 EESWELFEQRAFRNIQRKdEDLLKT-GKEMVQKCRGLPLCIVVLAGLLSR 377  

                   kskeeWedmLpRLrtsfgnsL.DgkIekvLrv...sYDgLhekDqaLFLh
                   k+  eW d+   L      +L+D+ I     v + s+ +L ++ +  FL+
  gi|1127800   378 KTPSEWNDVCNSLWR----RLkDDSIHVAPIVfdlSFKELRHESKLCFLY 423  

                   IACfFN.gekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkv
                     +f  ++e+  ++++l+              L+    I+ ++       
  gi|1127800   424 LSIFPEdYEI--DLEKLIH------------LLVAEGFIQGDE------- 452  

                   dgtieMHnLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTG
                       eM  + + ++R  I  ++ id      R  L   +           
  gi|1127800   453 ----EM--MMEDVARYYI--EELID------RSLLEAVR---------RE 479  

                   tgtrsVlGIslDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-
                    g  +V+      ++i +     + A ++   L F ++y++    +++  
  gi|1127800   480 RG--KVM-----SCRIHDL--LRDVAIKKSKELNFVNVYND--HVAQH   516  

                   *
                    
  gi|1127800     -   -    

gi|5918254|emb|CAB56299.1|: domain 1 of 1, from 140 to 486: score -160.8, E = 0.00023
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         + +VG E   e+m   L      e   V I G  GIGKTT A  
  gi|5918254   140    ---NIMVGRENEFEMMLDQLVRGG-RELEVVSIVGMGGIGKTTLATK 182  

                   Lfs..qLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyG
                   L+s++ +      s+F  +a  + ++                   eY   
  gi|5918254   183 LYSdpYIM-----SRFDIRAKAT-VS------------------QEYC-- 206  

                   mKLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDV......
                   +   L   +LS   +  D +  d    ++  Lk ++ L+++DD+ +++  
  gi|5918254   207 VRNVLLG-LLSLTSDEPDDQLAD---RLQKHLKGRRYLVVIDDIwttkaw 252  

                   DdleQLdALAketqWFGpGSRIIVTTeDkqLLka.......HgInhtIYe
                   D ++    L     ++  GSRI  TT + +  +  ++++++H   +    
  gi|5918254   253 DGIK----LCF-PDCY-KGSRILLTTRNVEVAEYassgkppHHMRLM--- 293  

                   VgfPSkeeALqIFCrsAFgQnsPp.dGFeeLeAreVtkLaGnLPLGLrVl
                         +e    ++   F +   ++  Fe++  ++++  +G LPL+  V 
  gi|5918254   294 ----NFDESWNLLHKKIFEKEGSYsPEFENI-GKQIALKCGGLPLAITVI 338  

                   GSsLRG..kskeeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqa
                      L   +k+ +eW ++     + +   L  k + vL  sY  L ++ + 
  gi|5918254   339 AGLLSKisKTLDEWQNVAENVSSVVSTDLEAKCMRVLALSYHHLPSHLKP 388  

                   LFLhIACfFN.gek..vdyVkalLadsnnLDVrqG..........LkvLa
                    FL+ A+f  +++++  ++V+ +  +  +L+ + G++ ++  ++  + L+
  gi|5918254   389 CFLYFAIFAEdERIsvTKLVELWAVEG-FLNEEEGksieevaetcINELV 437  

                   dKSLIhisplgnedkvdgtieMHnLLqqLGReAIVrkQsidhdePgKRqF
                   d+SLI+i +l+ +                  + I   +s           
  gi|5918254   438 DRSLISIHNLSFD-----------------GK-I---ES----------- 455  

                   LvDaeeIcdVLtdnTGtgtrsVlGIslDtseieeelnIsekAFegMrNLq
                                    g          ++ + +el+  e      rN  
  gi|5918254   456 ----------------CG----------MHDVTRELCLREA-----RNMN 474  

                   FLriykksfrddgk<-*
                   F ++ +   ++d++   
  gi|5918254   475 FVNVIRG--KSDQN    486  

gi|7649324|emb|CAB88869.1|: domain 1 of 1, from 1 to 168: score -160.9, E = 0.00023
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                +V           GKTTIAR+
  gi|7649324     1    -------------------------GGV-----------GKTTIARI 11   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    +   S       F    F +n+++  +ke i S                
  gi|7649324    12 IYKSVS-----YLFDGCYFLDNVKEALKKEGIAS---------------- 40   

                   LhLQeqfLSkILnqkDikIhdHLG...vieERLkdqKVLIiLDDVDdleQ
                     LQ+++L   L + +i I+ +  + + i+ R  + K LIiLDDVD++ Q
  gi|7649324    41 --LQQKLLTGALMKRNIDIP-NADgatLIKRRISNIKALIILDDVDNVSQ 87   

                   LdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqI
                   L  LA+   WFG+GSR+IVTT+   +L +HgI+   Y V+    +   q 
  gi|7649324    88 LRQLAGSLDWFGSGSRVIVTTKHEDILASHGIERR-YNVEVLKIDRGIQL 136  

                   FCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWe
                   F + AFg++ P++G+ +L + +V+  aG LP                   
  gi|7649324   137 FSQKAFGEDYPKEGYFDL-CSQVVDYAGGLP------------------- 166  

                   dmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvd
                                                                     
  gi|7649324     - -------------------------------------------------- -    

                   yVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqq
                                                                     
  gi|7649324   167 -----------------------------F-------------------- 167  

                   LGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslD
                       A                                             
  gi|7649324   168 ----A--------------------------------------------- 168  

                   tseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                          
  gi|7649324     - ------------------------------------    -    

gi|13897750|gb|AAK48436.1|AF255460_1: domain 1 of 1, from 1 to 166: score -161.0, E = 0.00023
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                +V           GKTT   A
  gi|1389775     1    -------------------------GGV-----------GKTTLVVA 11   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++ +      + F+  +F en+r      e  S+         ++    
  gi|1389775    12 VYNSIA-----DHFEALCFLENVR------EASSK---------HG---L 38   

                   LhLQeqfLSkILnqkDikIh....dHLGvieERLkdqKVLIiLDDVDdle
                   LhLQ  +LS+  +   ik  + +++    i+ RL+++KVL+iLDDVD+ e
  gi|1389775    39 LHLQSTLLSETVGE--IKLTsvkkG-ISIIQHRLQQKKVLLILDDVDKEE 85   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   QL ALA+  +WFG GSR+I+TT DkqLLk+Hg++ t YeV+         
  gi|1389775    86 QLQALAGRPHWFGLGSRVIITTRDKQLLKSHGVERT-YEVK--------- 125  

                   IFCrsAFgQnsPpdGFeeL.eAreVtkLaGnLPLGLrVlGSsLRGkskee
                                    eL+e                             
  gi|1389775   126 -----------------ELnE----------------------------- 129  

                   WedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgek
                    e++L  L                           +a        F  e+
  gi|1389775   130 -ENALELLTW-------------------------KA--------FKFEN 145  

                   vdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLL
                                                 ++p                 
  gi|1389775   146 ------------------------------FDP----------------- 148  

                   qqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIs
                               s                            +        
  gi|1389775   149 ------------SY---------------------------K-------- 151  

                   lDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                         + +ln                +     +  +    
  gi|1389775   152 ------D-VLNL--------------AVTYA--SGLPL    166  

gi|11278005|pir||T51185: domain 1 of 1, from 161 to 516: score -161.1, E = 0.00023
                   *->rDFddlVGiEaHlek.mksLLcLdskdeVrMVGIwGPaGIGKTTIAR
                         +  VG+E+  +  ++ LL+ + k  + ++ I G  G GKT  AR
  gi|1127800   161    ---EVVVGLEDDAKIlLEKLLDYEEK-NRFIISIFGMGGLGKTALAR 203  

                   ALfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGm
                    L++  S r  +++F+ +a  + ++  y+  +i  +  ++ +l   s G 
  gi|1127800   204 KLYN--S-RDVKERFEYRAWTY-VSQEYKTGDILMR--IIRSLGMTS-GE 246  

                   KLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDV......D
                    L   ++f       + +++      +   L  +K L++ DD+ +++  +
  gi|1127800   247 ELEKIRKF-----ADEELEVY-----LHGLLEGKKYLVVVDDIwereawE 286  

                   dleQLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIY..eVgfPSk
                    l+   AL    +    GSR+I+TT  k    a g++  +Y ++  f + 
  gi|1127800   287 SLK--RALPCNHE----GSRVIITTRIKA--VAEGVDGRFYahKLRFLTF 328  

                   eeALqIFCrsAFgQnsPp.dGFeeLeAreVtkLaGnLPLGLrVlGSsLRG
                   ee  + F + AF+  +  +++  +   +e +  +  LPL+  Vl   L +
  gi|1127800   329 EESWELFEQRAFRNIQRNdEDLLKT-GKEMVQKCRGLPLCIVVLAGLLSR 377  

                   kskeeWedmLpRLrtsfgnsL.DgkIekvLrv...sYDgLhekDqaLFLh
                   k+  eW d+   L      +L+D+ I     v + s+ +L ++ +  FL+
  gi|1127800   378 KTPSEWNDVCNSLWR----RLkDDSIHVAPIVfdlSFKELRHESKLCFLY 423  

                   IACfFN.gekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkv
                     +f  ++e+  +V++l+              L+    I+ ++       
  gi|1127800   424 LSIFPEdYEI--DVEKLIR------------LLVAEGFIQGDE------- 452  

                   dgtieMHnLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTG
                       eM  + + ++R  I  ++ id      R  L   +           
  gi|1127800   453 ----EM--MMEDVARYYI--EELID------RSLLEAVR---------RE 479  

                   tgtrsVlGIslDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-
                    g  +V+      ++i +     + A ++   L F ++y++    +++  
  gi|1127800   480 RG--KVM-----SCRIHDL--LRDVAIKKSKELNFVNVYND--HVAQH   516  

                   *
                    
  gi|1127800     -   -    

gi|13872897|dbj|BAB44004.1|: domain 1 of 1, from 171 to 557: score -161.5, E = 0.00025
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMV.GIwGPaGIGKTTIAR
                      r  dd+V      +++ s    ++ d +  V GI G  GIGKTT A 
  gi|1387289   171    RAVDDMV------KMIVS----NYNDNRSTVfGIQGMGGIGKTTLAQ 207  

                   ALfs..qLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsy
                     ++++++      ++Fq ++    ++ +y           + +l     
  gi|1387289   208 KIYNeqRIR-----EKFQVHIWLC-ISQNY----------TETSLLKQA- 240  

                   GmKLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQ
                           ++   I +q   k +  L  + +  + + V+++LDDV ++++
  gi|1387289   241 -------IRMAGGICDQLETKTE-LLPLLVDTIRGKSVFLVLDDVWKSDV 282  

                   LdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqI
                      L    +  G  SRI VT  +   L      +t   V    +++ L+ 
  gi|1387289   283 WIDLLRSPSERGLNSRILVTSRNLDVLVEMHATYT-HRVNKMNDYDGLEL 331  

                   FCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLR.GkskeeW
                   +     g    +  F     ++++k ++ LPL+ +V+   L + k+k eW
  gi|1387289   332 LMKMSLGPYEQRREFSGV-GYQIVKKCDGLPLAIKVVAGVLSsKKTKAEW 380  

                   edm......LpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACf
                   e +++++ +++ L +     L g     L  sY  L  + +  FL  A +
  gi|1387289   381 ESIrdskwsIHGLPK----ELGGP----LYLSYSNLPPELKQFFLWCALL 422  

                   .FN.gekvdyVkalLadsnnLDVrqGLkvLa.....dKSLIhisplgned
                   + N g ++d V  +  + +++   +G  +    ++ +  LI+++ l+ + 
  gi|1387289   423 pSNfGIHRDAVAYWWVAEGFVTKMHGYSIHEaaeeyYHELIRMNLLQPKP 472  

                   kv.dgti.eMHnLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLt
                   +  d++ + MH+LL+ LG       +s    + +  + L + +  + V +
  gi|1387289   473 EFvDKWMsTMHDLLRSLGQF-LTKDHSL-FMNMENSKTLLNLR--HLVIS 518  

                   dnTGtgtrsVlGIslDtseieeelnIsekAFegMrNLqFLriykksfrdd
                   ++   +          +  ie el    +++    N  F  i+k++fr  
  gi|1387289   519 NDVK-E----------IPAIE-ELKC-LRSLLIFNNKNFKTINKDIFREL 555  

                   gk<-*
                   ++   
  gi|1387289   556 KH    557  

gi|6635380|gb|AAF19803.1|: domain 1 of 1, from 156 to 549: score -162.3, E = 0.00027
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                            VGi   +e    LL  +  +e+ ++G++GP G+GKTT    
  gi|6635380   156    -----VVGITTMMEQVWELLS-EE-EERGIIGVYGPGGVGKTTLMQS 195  

                   LfsqLSerhFq.ssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGm
                     + L     +++++   + ++ +r+ ++        t+   +  +   +
  gi|6635380   196 INNELI---TKgHQYDVLIWVTMSREFGE-------CTIQRAVGAR---L 232  

                   KLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDV.DdleQL
                    L++ e+   +       +I          Lk+++ L+ LDDV + +++ 
  gi|6635380   233 GLSWDEK---ETGEGRAFRIY-RA------LKQRRFLLLLDDVwEEIDFE 272  

                   dALA....ketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeA
                   ++ +++++ e ++      I  TT    L    g +++   V+f  k++A
  gi|6635380   273 KTGVprpdRENKC-----KIMFTTRFLALCSNIGAECK-LRVEFLEKQHA 316  

                   LqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLR.Gksk
                    + FC    ++++         A+ +++ +G LPL+L  lG ++ +++++
  gi|6635380   317 WEFFCGKVGRRDFLESPLIRRHAENIVTKCGGLPLALITLGGAMAhRETE 366  

                   eeWe...dmLpRLrtsfgnsLDgkIekvLrvsYDgLhek.DqaLFLhIAC
                   eeW++ +++L R+     ++ D  +   L++sYD L +      FL+ A 
  gi|6635380   367 EEWIhanEVLNRFPA-EMKGMDY-VFALLKFSYDNLESDlLRTCFLYCAL 414  

                   fFN.g..ekvdyVkalLadsnnLDVrqGLkv..........LadKSLIhi
                   f  +++ e+  +V+ + ++  +L  ++G ++  ++    ++L   +L+  
  gi|6635380   415 FPEdHsiEIEQLVEYWVGEG-FLISSHGVNTiyqgyflvgdLKAACLVET 463  

                   splgnedkvdgtieMHnLLqqLGReAIVrkQsidhdePgKRqFLvDaeeI
                    +++++      ++MHn  + ++      +Q ++     K  +Lv++   
  gi|6635380   464 GDEKTQ------VKMHNVVRSFALW-MASEQGTY-----KELILVEPS-- 499  

                   cdVLtdnTGtgtrsVlGIslDtseieeelnIsekAFegMrNLqFLriykk
                       +  +  ++r  l Isl  ++++   +  e+     +NL  L    +
  gi|6635380   500 MGLTEAPKTERWRHTLVISLLDNRLQ---MLPENPIC--PNLTTLLLQQN 544  

                   sfrddgk<-*
                     ++ +k   
  gi|6635380   545 --SSLKK    549  

gi|7107266|gb|AAF36347.1|AF186639_1: domain 1 of 1, from 1 to 169: score -162.5, E = 0.00028
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                           G+GKTTIA+A
  gi|7107266     1    -------------------------------------GVGKTTIAKA 10   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++++      ++F+ + F  n+r+            r    D      +
  gi|7107266    11 IYNKIG-----RNFEGRSFLANIREVW----------RQ---DA----GQ 38   

                   LhLQeqfLSkILnqkDikIhdHL....GvieERLkdqKVLIiLDDVDdle
                    +LQeq+L  I +    +I+ + ++++  ++  L  +KVL++LDDV+ l+
  gi|7107266    39 VNLQEQLLFDINKETKTRIR-NVesgkNILKKILSYKKVLLVLDDVNELD 87   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   QL AL +  +WF pGSRII+T  D+ +L+  +++   Y  +   ++e  +
  gi|7107266    88 QLNALCGSDKWFAPGSRIIITIRDQDILRG-RVDI-LYTMKGMDEGESIE 135  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    F  +AF+Q sP++ F +L +r V+   G LPL+L               
  gi|7107266   136 LFSWHAFKQASPRENFTQL-SRNVIMYSGGLPLAL--------------- 169  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                                                                     
  gi|7107266     - -------------------------------------------------- -    

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                                                                     
  gi|7107266     - -------------------------------------------------- -    

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                                                                     
  gi|7107266     - -------------------------------------------------- -    

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                           
  gi|7107266     - -------------------------------------    -    

gi|13702829|gb|AAK38505.1|AC087181_21: domain 1 of 1, from 172 to 573: score -163.8, E = 0.00032
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                          +++        ++ LL+     eV  VGI G  G+GKTT A  
  gi|1370282   172    ----GMI--------IDRLLRCTAHREV--VGIVGMGGVGKTTLASL 204  

                   LfsqLSerhFqssFqlsaFmenlrgsysk..........eeigSg....e
                    +++ S              + lr    +++++++++++ e++       
  gi|1370282   205 VYNKVS--------AIQTGGTSLR---PDspkgtssrssVEMYFDacawV 243  

                   trpaglDeYsyGmKLhLQeqfLSkIL.nqkDikIhd.HLGvieE....RL
                   +   + D  +           L kI++ q +++ + ++  ++++   + L
  gi|1370282   244 PVGQNADALG-----------LLKITsAQIGVELNStQVAAAKNamfrFL 282  

                   kdqKVLIiLDDV....DdleQLdALAketqWFGpGSRIIVTTeDkqLLka
                   +++K LI+LDD+ +++  le+ +A  k t    +GS I  TT  k++  +
  gi|1370282   283 QHKKYLIVLDDIwtteTWLELSEAFPKST----NGSKILLTTRSKEIAVS 328  

                   Hg.InhtIYeVgfPSkeeALqIFCrsAFgQn.....sPpdGFeeLeAreV
                    ++  +  Ye +  S+e+ +q F    Fg n+ +++s p   ++    + 
  gi|1370282   329 ADpSSLP-YELDPLSEELSFQLFITKVFGLNhvdttSCPPQLKDV-GHQL 376  

                   tkLaGnLPLGLrVlGSsLRGksk..eeWedmLpRLrtsfgnsLDgkIekv
                    k +G LPL+L VlG  L Gk k+ e W ++L   + s  +  ++   ++
  gi|1370282   377 SKKCGGLPLALVVLGGLLSGKEKqfEVWRNILKSMKWSNYEAGNQ-CLEI 425  

                   LrvsYDgLhekDqaLFLhIACfFNgekv...dyVkalLadsnnLDVrqG.
                   L  sY  L  + +  F +   f  + +++ ++++k +++d+ +   + G+
  gi|1370282   426 LALSYSCLPYHMKLCFMYLGAFKEETEIsvsKLIKLWIGDD-FIPQQDGk 474  

                   .........LkvLadKSLIhisplgnedkv.dgtieMHnLLqqLGReAIV
                   +++++ ++ L  L +++L++  pl  ++k++ ++++ H LL +L+R    
  gi|1370282   475 treetandyLRELIQRCLVQ--PLLPAHKQgFKRVRIHGLLCELARS--- 519  

                   rkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtseieee
                           e ++ +F    +   d  + + G             +++   
  gi|1370282   520 --------EARESRFFYCEN--GDAVSRAEGKY----------YRRLA-- 547  

                   lnIsekAFegMrN...LqFLriykksfrddgk<-*
                   l+    AF  ++N+++L+ L i+       g    
  gi|1370282   548 LHTKLIAFHELSNsekLRSLLIF------PGV    573  

gi|7443913|pir||T12979: domain 1 of 1, from 155 to 511: score -164.3, E = 0.00034
                   *->rDFdd.lVGiEaHlek.mksLLcLdskdeVrMVGIwGPaGIGKTTIA
                       D +++ VG+ +  +  +  LL+ d ++   M+ I G  G GKT  A
  gi|7443913   155    DDQEErVVGLTDDAKVlLTKLLDDDGDNKIYMISIFGMEGLGKTSLA 201  

                   RALfs..qLSerhFqssFqlsaFmenlrgsyskeeigSg..etrpaglDe
                   R Lf+++        +sF+ ++  +n++g     e   ++   r++++ e
  gi|7443913   202 RKLFNssDVK-----ESFEYRVW-TNVSG-----ECNTRdiLMRIISSLE 240  

                   YsyGmKLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDd
                       +   L+++       q+ +++      + + L+ ++ L++ DD+  
  gi|7443913   241 ET--SEGELEKM------AQQELEVY-----LHDILQEKRYLVVVDDIWE 277  

                   leQLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIY..eVgfPSke
                   +e L+ L     +   GSR+I+TT  +   +  + +  +Y++   f + +
  gi|7443913   278 SEALESLKRALPCSYQGSRVIITTSIRVVAEGRD-KR-VYthNIRFLTFK 325  

                   eALqIFCrsAFgQns.PpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGk
                   e    F   AF+   +     +++  +e +  +G LP    Vl   + +k
  gi|7443913   326 ESWNLFEKKAFRYILkVDQELQKI-GKEMVQKCGGLPRTTVVLAGLMSRK 374  

                   skeeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfF
                   + +eW d+   Lr    +  +  + +    s+ +  ++ +  FL+  +f 
  gi|7443913   375 KPNEWNDVWSSLRV---KDDNIHVSSLFDLSFKDMGHELKLCFLYLSVFP 421  

                   N.gekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtie
                    ++e   +V++l+              L+    I+ +++           
  gi|7443913   422 EdYEV--DVEKLIQ------------LLVAEGFIQEDEE---------MT 448  

                   MHnLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrs
                   M    + ++R        i+ d       Lv      +V   ++G     
  gi|7443913   449 M----EDVARY------YIE-D-------LVYIS-LVEVVKRKKGKL--- 476  

                   VlGIslDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                      +s+ ++ + +e+ I     ++   L F ++y+   ++++    
  gi|7443913   477 ---MSFRIHDLVREFTI-----KKSKELNFVNVYDEQHSSTTS    511  

gi|13937094|gb|AAK50046.1|AF363801_1: domain 1 of 1, from 1 to 167: score -164.8, E = 0.00036
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                ++           GKTTIAR 
  gi|1393709     1    -------------------------GGM-----------GKTTIARL 11   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    +         ++F  s+F en+r+           + ++gl        
  gi|1393709    12 VYEAVK-----EKFKVSCFLENIRE----------LSKTNGLV------- 39   

                   LhLQeqfLSkILnqkDikIhdHL....GvieERLkdqKVLIiLDDVDdle
                    h Q++ LS  Ln      + +L +++  i + L ++KVL++LDDV ++ 
  gi|1393709    40 -HIQKEILSH-LNVRSNDFC-NLydgkKIIANSLSNKKVLLVLDDVSHIS 86   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   QL+ L ++ +WFGpGSR I+TT Dk+LLk +g++ t Y+     + eALq
  gi|1393709    87 QLENLGGKREWFGPGSRLIITTRDKHLLKTYGVDMT-YKARGLAQNEALQ 135  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    FC+ AF+Q++P++G+    ++ V++ a  LP                  
  gi|1393709   136 LFCLTAFKQDQPKEGYFTF-CKGVVEYA-TLP------------------ 165  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                          r+                                         
  gi|1393709   166 -------RS----------------------------------------- 167  

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                                                                     
  gi|1393709     - -------------------------------------------------- -    

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                                                                     
  gi|1393709     - -------------------------------------------------- -    

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                           
  gi|1393709     - -------------------------------------    -    

gi|15088547|gb|AAK84083.1|AF326781_9: domain 1 of 1, from 150 to 494: score -164.9, E = 0.00037
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                       +  dlVGi+    ++   L+    de + V I G aG GKTT A+ 
  gi|1508854   150    TCAADLVGIDGPKYELVKWLRNGE-DEQKVVSIVGCAGLGKTTLAKQ 195  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++ L        F+ +aF++ ++                ++D     +K
  gi|1508854   196 VYDELR-----VTFEYRAFVS-IS---------------QSPDMAT-ILK 223  

                   LhLQeqfLSkILnqkDikIhdHL.GvieERLkdqKVLIiLDDVDdle...
                     L  qf ++    + i+I+  L   i++ L+d++ ++i+DD+ d ++ +
  gi|1508854   224 CVL-SQFHAQDYSSDEIEIP-KLiNQIRDFLQDKRYFVIIDDIWDMMtwn 271  

                   QLd.ALAketqWFGpGSRIIVTT...eDkqLLkaHgInhtIYeVgfPSke
                   +L+ AL k +    +GS I  TT+     +L  + + ++ +Y     S  
  gi|1508854   272 VLKcALCKNS----CGSVIMTTTriyDVAKLCCSSDGDL-VYNIRPLSVA 316  

                   eALqIFCrsAFg..QnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLR.
                   +  + F    Fg+++ +Pp+  +e  ++ V k +G LPL+ +     L  
  gi|1508854   317 DSEKLFLNRVFGheKEFPPEL-KEV-SKDVLKKCGGLPLAINAISRLLAa 364  

                   GkskeeW..edmLpRLrtsfgnsLDgkIek.vLrvsYDgLhekDqaLFLh
                    ++keeW+++ +   +    g+  D + +k +L  sY +L  +  +  L+
  gi|1508854   365 EENKEEWghVGLSSVFVR--GEKSDIDAMKyILSLSYFDLPPHLRSCLLY 412  

                   IACfFN.g..ekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgned
                    A f  ++  ek  +V+ ++ +                  Ih ++ g + 
  gi|1508854   413 LAMFPEdCliEKERLVHRWISEG----------------FIH-NEAGLC- 444  

                   kvdgtieMHnLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdn
                              L+++G e      s                       ++
  gi|1508854   445 -----------LVEVG-E------SY---------------------LYE 455  

                   TGtgtrsVlGIslDtseiee.elnIsekA.FegMrN..LqFLriykksfr
                     ++           s ie   +  + kA+F + +N  L FL ++    +
  gi|1508854   456 LVNR-----------SLIESvGVPYDRKArFYRVHNviLDFLIFK----S 490  

                   ddgk<-*
                    +++   
  gi|1508854   491 MEEN    494  

gi|7488665|pir||T08824: domain 1 of 1, from 1 to 169: score -165.4, E = 0.00039
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                +V           GKTT   A
  gi|7488665     1    -------------------------GGV-----------GKTTLVTA 11   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   Lf ++S      ++  ++F++ l             +   ++        
  gi|7488665    12 LFGKIS-----PQYDARCFIDDLN------------KKCGNFGA------ 38   

                   LhLQeqfLSkILnqkDikIhdHLG....vieERLkdqKVLIiLDDVDdle
                    + Q+q+LS  L q +++Ih +L +++  i+ RL++ K LI+LD VD++e
  gi|7488665    39 ISAQKQLLSLALHQGNMEIH-NLShgtmLIRTRLCHLKTLIVLDNVDQVE 87   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   QL+ LA   +  G GSR I++  + ++L+ +g++  +Y V +  k+ ALq
  gi|7488665    88 QLENLALHREYLGEGSRTIIISTNMHILRNYGVDG-VYNVQLLNKDKALQ 136  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    +C  AF+ +    G+ee  +  V k +  LPL                 
  gi|7488665   137 LLCKKAFKSDDIVKGYEEV-THDVLKYVNGLPL----------------- 168  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                                                                     
  gi|7488665     - -------------------------------------------------- -    

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                                                                     
  gi|7488665     - -------------------------------------------------- -    

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                        A                                            
  gi|7488665   169 -----A-------------------------------------------- 169  

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                           
  gi|7488665     - -------------------------------------    -    

gi|13937100|gb|AAK50049.1|AF363804_1: domain 1 of 1, from 1 to 170: score -165.9, E = 0.00041
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                +V           GKTT A  
  gi|1393710     1    -------------------------GGV-----------GKTTLANT 11   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   Lf ++S      ++   + ++ l+++y              l   s    
  gi|1393710    12 LFKKIS-----PKYDAWCYIDDLSKIY------------LDLGVTS---- 40   

                   LhLQeqfLSkILnqkDikIhdHLG....vieERLkdqKVLIiLDDVDdle
                      Q+q+L ++Lnq +++Ih H  +++  +++RL++ K LI+LD VD++e
  gi|1393710    41 --AQKQLLCQVLNQGNMEIH-HVShgtmLMKNRLRHLKTLIVLDNVDQVE 87   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   QL+ L    +  GpGSRII++  D  +L+ +g+n  +Y V+   +  AL+
  gi|1393710    88 QLEKLGLHPEYIGPGSRIIIISTDCRILQNYGVNE-VYNVKVLDETQALK 136  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    FC  AF+ +  p  +eeL ++ V k +  LPL+L               
  gi|1393710   137 LFCKRAFKSKDIPKEYEEL-TFDVLKYVKGLPLAL--------------- 170  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                                                                     
  gi|1393710     - -------------------------------------------------- -    

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                                                                     
  gi|1393710     - -------------------------------------------------- -    

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                                                                     
  gi|1393710     - -------------------------------------------------- -    

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                           
  gi|1393710     - -------------------------------------    -    

gi|7485661|pir||T05981: domain 1 of 1, from 175 to 579: score -166.0, E = 0.00042
                   *->rDFddl.VGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIAR
                       D + ++VG+E    k k +  ++s  +V   GI+G  G+GKTT A+
  gi|7485661   175    DDSEKFgVGLELGKVKVKKM-MFESQGGV--FGISGMGGVGKTTLAK 218  

                   ALfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGm
                    L   +     q  F+ ++    ++         S  +   +l e     
  gi|7485661   219 ELQRDHE---VQCHFENRILFLTVS--------QS--PLLEELRE----- 250  

                   KLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLd
                      L   fLS   +  +  ++ ++          + L+iLDDV   + Ld
  gi|7485661   251 ---LIWGFLSG--CEAGNPVP-DC---NFPFDGARKLVILDDVWTTQALD 291  

                   ALAketqWFGpGSRIIVT.....TeDkqLLkaHgInhtIYeVgfPSkeeA
                    L      F pG    V+++++ Te k          t Y V+  S++eA
  gi|7485661   292 RLTS--FKF-PGCTTLVVsrsklTEPKF---------T-YDVEVLSEDEA 328  

                   LqIFCrsAFgQnsPpdGFee................L.eAreVtkLaGnL
                      FC++AFgQ+s p GF ++  ++++ ++ +  + L    +V++ +  L
  gi|7485661   329 ISLFCLCAFGQKSIPLGFCKdlvkqhniqsfsilrvLcL-AQVANECKGL 377  

                   PLGLrVlGSsLRGkskeeWedmLpRLrtsfgnsLDgkIek.vLr...vsY
                   PL+L+V G sL Gk + +W+ +L RL +  g+  D+  e++ Lr+ + s 
  gi|7485661   378 PLALKVTGASLNGKPEMYWKGVLQRLSK--GEPADDSHESrLLRqmeASL 425  

                   DgLhekDqaLFLhIACfFNgekv...dyVkalLadsnnLDVrqGLkvLad
                   D L++  ++ FL    f   +k++ + ++  +++   + D  + + +L+d
  gi|7485661   426 DNLDQTTKDCFLDLGAFPEDRKIpldVLINIWIELH-DIDEGNAFAILVD 474  

                   KSLIhisplgne.......d.kvdgtieMHnLLqqLGReAIVrkQsidhd
                    S  +  +lg++++ ++   ++ d ++  H+ L+ L+      + ++   
  gi|7485661   475 LSHKNLLTLGKDprlgslyAsHYDIFVTQHDVLRDLALH-LSNAGKV--- 520  

                   ePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtseieeelnIs.ekA
                   + +KR      e   d   d   +          D + i + ++I++ k 
  gi|7485661   521 NRRKRLLMPKRE--LDLPGDWERNN---------DEHYIAQIVSIHtGKC 559  

                   FegMrNLqFLriykksfrddgk<-*
                   F  +  ++ L+ +++  +d++    
  gi|7485661   560 FSTLQIFLVLSCNNH--QDHNV    579  

gi|13661831|gb|AAK38117.1|AF368301_1: domain 1 of 1, from 155 to 548: score -166.4, E = 0.00044
                   *->rDFddlVGiEaHlekmksLLcLdskdeVr.MVGIwGPaGIGKTTIAR
                            VG     ++m++ L + s++e r+++G++GP G+GKTT   
  gi|1366183   155    -----VVG---NTTMMEQVLEFLSEEEERgIIGVYGPGGVGKTTLMQ 193  

                   ALfsqLSerhFq.ssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyG
                      + L     +++++   + +  +r+ ++        t+   +  +   
  gi|1366183   194 SINNELI---TKgHQYDVLIWVQMSREFGE-------CTIQQAVGAR--- 230  

                   mKLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDV.DdleQ
                   + L++ e+   +      +kI          L++++ L+ LDDV + +++
  gi|1366183   231 LGLSWDEK---ETGENRALKIY-RA------LRQKRFLLLLDDVwEEIDL 270  

                   LdALA....ketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkee
                    ++ +++++ e ++      +  TT    L    g +++   V+f  k++
  gi|1366183   271 EKTGVprpdRENKC-----KVMFTTRSIALCNNMGAEYK-LRVEFLEKKH 314  

                   ALqIFCrsAFgQnsPp.dGFeeLeAreVtkLaGnLPLGLrVlGSsLR.Gk
                   A + FC   ++++   +     L A+ ++  +G LPL+L  lG ++ +++
  gi|1366183   315 AWELFCSKVWRKDLLEsSSIRRL-AEIIVSKCGGLPLALITLGGAMAhRE 363  

                   skeeWe...dmLpRLrtsfgnsLDgkIekvLrvsYDgLhek.DqaLFLhI
                   ++eeW++ +++L R+     ++ +  +   L++sYD L +    + FL+ 
  gi|1366183   364 TEEEWIhasEVLTRFPA-EMKGMNY-VFALLKFSYDNLESDlLRSCFLYC 411  

                   ACfFN.g..ekvdyVkalLadsnnLDVrqGLkv..........LadKSLI
                   A f  +++ e+  +V+ + ++  +L  ++G ++  ++    ++L   +L 
  gi|1366183   412 ALFPEeHpiEIEQLVEYWVGEG-FLTSSNGVNTiykgyfligdLKAACLL 460  

                   hisplgnedkvdgtieMHnLLqqLGReAIVrkQsidhdePgKRqFLvDae
                      +++++      ++M n  + ++      +Q ++     K  +Lv++ 
  gi|1366183   461 ETGDEKTQ------VKMYNVVRSFALW-MASEQGTY-----KELILVEPS 498  

                   eIcdVLtdnTGtgtrsVlGIslDtseieeelnIsekAFegMrNLqFLriy
                         +  +   +r  l Isl  ++i+      ek     + L  L   
  gi|1366183   499 --MGHTEAPKAENWRQALVISLLDNRIQ---TLPEKLIC--PKLTTLMLQ 541  

                   kksfrddgk<-*
                    +  ++ +k   
  gi|1366183   542 QN--SYLKK    548  

gi|7107260|gb|AAF36344.1|AF186636_1: domain 1 of 1, from 1 to 170: score -166.8, E = 0.00046
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                +V           GKTT A +
  gi|7107260     1    -------------------------GGV-----------GKTTLATV 11   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L+ ++      +++  ++F++ l++ y          r  g+        
  gi|7107260    12 LYHRIC-----HQYTARCFIDDLSKVY----------RDFGPIGAL---- 42   

                   LhLQeqfLSkILnqkDikIhdHL....GvieERLkdqKVLIiLDDVDdle
                       +q+L + Ln +++ I+ +L +    i+ RL+  K LI+LD VD +e
  gi|7107260    43 ----KQLLCQTLNEENLHIS-NLynaaNLIRSRLRYVKTLIVLDNVDEVE 87   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   QL+ L+ + qWFG GSRII++  +k +L+ +g++  +Y+V +     AL+
  gi|7107260    88 QLEKLVVDRQWFGAGSRIIIISRNKRILEKYGVDV-VYKVQLLNSTNALK 136  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    FC  AF      ++++ L ++ V   a  LPL+L               
  gi|7107260   137 LFCKKAFHSEDIVYDYKSL-TNDVLQYAKGLPLAL--------------- 170  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                                                                     
  gi|7107260     - -------------------------------------------------- -    

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                                                                     
  gi|7107260     - -------------------------------------------------- -    

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                                                                     
  gi|7107260     - -------------------------------------------------- -    

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                           
  gi|7107260     - -------------------------------------    -    

gi|10177941|dbj|BAB11300.1|: domain 1 of 1, from 154 to 550: score -167.7, E = 0.00051
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         d +VGi     + +sL +    de r  G +G  GIGKTT    
  gi|1017794   154    VGLDTMVGI-----AWESLID----DEIRTLGLYGMGGIGKTTLLES 191  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L +++   + +s F   + +  ++                     +  ++
  gi|1017794   192 LNNKFV--ELESEFDVVIWVVVSK---------------------D--FQ 216  

                   Lh.LQeqfLSkILnqk....DikIhdHLGvieERLkdqKVLIiLDDV.Dd
                   L + Q q L  +   k+ ++  +       i + Lk +K  + LDD+   
  gi|1017794   217 LEgIQDQILGRLRPDKewerETESK-KASLINNNLKRKKFVLLLDDLwSE 265  

                   leQLdALAketqWFG.......pGSRIIVTTeDkqLLkaHgInhtIYeVg
                   ++    L k     G +++++++GS I+ TT  k+  k    + +  +V+
  gi|1017794   266 VD----LIK----IGvpppsreNGSKIVFTTRSKEVCKHMKADKQ-IKVD 306  

                   fPSkeeALqIFCrsAFgQnsPp..dGFeeLeAreVtkLaGnLPLGLrVlG
                     S +eA + F r   g    +++ +   L Ar V+  +  LPL+L+V G
  gi|1017794   307 CLSPDEAWELF-RLTVGDIILRshQDIPAL-ARIVAAKCHGLPLALNVIG 354  

                   SsLR.GkskeeWedmLpRLrtsfgn...sLDgkIekvLrvsYDgLhek.D
                    ++   ++ +eW  ++  L +  g++ ++  ++I  +L++sYD+L + + 
  gi|1017794   355 KAMVcKETVQEWRHAINVLNS-PGHkfpGMEERILPILKFSYDSLKNGeI 403  

                   qaLFLhIACf...FNgekvdyVkalLadsnnLD........VrqGLkvLa
                   +  FL+   f+++F  ek+++++ ++ +    ++++ ++++ +qG  +  
  gi|1017794   404 KLCFLYCSLFpedFEIEKDKLIEYWICEG-YINpnryedggTNQGYDIIG 452  

                   dKSLIhisplgnedkvdgtieMHnLLqqLGReAIVrk....QsidhdePg
                      L++   l ++ ++ + ++MH+  ++++   I    +++Q++      
  gi|1017794   453 --LLVRAHLLIEC-ELTDKVKMHDVIREMALW-INSDfgnqQET------ 492  

                   KRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtseieeelnIsekAFegM
                      + v +        +++  +   V  +sl  + +e ++  s +     
  gi|1017794   493 ---ICVKSGAHVRLIPNDISWE--IVRQMSLISTQVE-KIACSPNC---- 532  

                   rNLqFLriykksfrddgk<-*
                   +NL  L    ++  d      
  gi|1017794   533 PNLSTLLLPYNKLVDISV    550  

gi|7489353|pir||T30559: domain 1 of 1, from 150 to 543: score -168.6, E = 0.00057
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      +DF+     + H +  k L  L s     MV  wG  G+GKTT  + 
  gi|7489353   150    NDFES----REH-TFRKALEALGSNHTSHMVALWGMGGVGKTTMMKR 191  

                   LfsqLSerhFq.ssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGm
                   L + +     +++ F+  + +  +++++   +  S   +   + +Y   m
  gi|7489353   192 LKNIIK----EkRTFHYIVLVV-IKENM---DLIS---IQDAVADY-LDM 229  

                   KL..........hLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiL
                   KL++++++++ + L+e f +k         + + G         + LIiL
  gi|7489353   230 KLtesneseradKLREGFQAK---------S-DGG-------KNRFLIIL 262  

                   DDV......DdleQLdALAketqWFGpGSRIIVTTeDkqLLkaHgInht.
                   DDV ++ + +d+  L    ++    G    +  T e+k      g++ + 
  gi|7489353   263 DDVwqsvnmEDIG-LSPFPNQ----GVDFKVLLTSENKDVCAKMGVEANl 307  

                   IYeVgfPSkeeALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLr
                   I  V+f ++eeA   F  + F + s  +   ++  + +++ +G LP + +
  gi|7489353   308 IFDVKFLTEEEAQSLF--YQFVKVSDTHL-DKI-GKAIVRNCGGLPIAIK 353  

                   VlGSsLRGkskeeWedmLpRLrtsfgnsLDgkIekv....LrvsYDgLhe
                        L+ ++k+ W+d+L R++         +Ie + +   + sYD L +
  gi|7489353   354 TIANTLKNRNKDVWKDALSRIEH-------HDIETIahvvFQMSYDNLQN 396  

                   k.DqaLFLhIACf....................FN..gekvd.......y
                   ++ q++FL+   f+++ + ++++  + + + + FN+ + + + +++ + y
  gi|7489353   397 EeAQSIFLLCGLFpedfdipteelvrygwglrvFNgvYTIGEarhrlnaY 446  

                   VkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqL
                   ++ lL dsn               LI  ++ +       +i+MH+L + +
  gi|7489353   447 IE-LLKDSN--------------LLIESDDVH-------CIKMHDLVRAF 474  

                   GReAIVrk..QsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                     +    + ++s    + g    L  +e       ++   +  s   Isl
  gi|7489353   475 VLD-TFNRfkHSL-IVNHGNGGMLGWPE-------NDMSAS--SCKRISL 513  

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                      +++  +  + k     +NL+ L+      +++ k   
  gi|7489353   514 ICKGMS-DFPRDVK----FPNLLILKLMHA--DKSLK    543  

gi|6573285|dbj|BAA88265.1|: domain 1 of 1, from 157 to 525: score -169.1, E = 0.0006
                   *->rDFd.dlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIAR
                      +D ++d+VG+E   +k+   L  d  + V  V I G  G GKTT AR
  gi|6573285   157    KDYEsDFVGLEVNVKKLVGYL-VDE-ENVQVVSITGMGGLGKTTLAR 201  

                   ALfs..qLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsy
                     f+++        ++F   a +  + +          +tr+   +    
  gi|6573285   202 QVFNheDVK-----HQFDRLAWVCVSQE----------FTRK---NV--- 230  

                   GmKLhLQeqfLS.....kILnqkDikIhdHLGvieERLkdqKVLIiLDDV
                    ++  LQ+ + S++++++IL ++  + hd    + + L   K LI+ DD+
  gi|6573285   231 -WQMILQN-LTSrekkdEILQMEEAELHD---KLFQLLETSKSLIVFDDI 275  

                   ...DdleQLdAL..AketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVg
                    +++d ++ + + + +       G  +  T ++       +I++      
  gi|6573285   276 wkdEDWDLIKPIfpPN------KGWKVLLTSQNESVAVRGDIKYL----N 315  

                   fPSkeeALq....IFCrsAFgQnsPpd.....GFeeLeAreVtkLaGnLP
                   f  + +A +++ + F r AF ++ + +++ ++  e+   ++  k++G LP
  gi|6573285   316 FKPECLAIEdswtLFQRIAFPKKDASEskvdeEMEDM-GKQMLKHCGGLP 364  

                   LGLrVlGSsLR.GkskeeWedmLpRL......rtsfgnsLDgkIekvLrv
                   L+ +VlG  L    + ++We++   ++++  +rts   s +  I  vL  
  gi|6573285   365 LAIKVLGGLLAaKYTMHDWERLSVNIgsdivgRTS---SNNSSIYHVLSM 411  

                   sYDgLhekDqaLFLhIACfFN..gekvdyVkalLadsnnLDVrqGLkvLa
                   s+++L +  +  FL+ A f  +++ +v+++    a+ +            
  gi|6573285   412 SFEELPSYLKHCFLYLAHFPEdhKINVEKLSYCWAAEG------------ 449  

                   dKSLIhisplgnedkvdgtieMHnLLqqLGReAIVrk..QsidhdePgKR
                       I+  +   +                  e  ++  +Qs   +e   R
  gi|6573285   450 ----ISTAEDYHN-----------------GE-TIQDvgQSY-LEELVRR 476  

                   qFLvDaeeIcdVLtdnTGtgtrsVlGIslDtseieeelnIsekAFegMrN
                      +  +       d+T ++        + t+ +    ++ e  + +   
  gi|6573285   477 NMIIWER-------DATASR--------FGTCHLH-D-MMREVCLFKAKE 509  

                   LqFLriykksfrddgk<-*
                     FL i  ks + +     
  gi|6573285   510 ENFLQIAVKSVGVTSS    525  

gi|12321042|gb|AAG50638.1|AC082643_2: domain 1 of 1, from 157 to 525: score -169.1, E = 0.0006
                   *->rDFd.dlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIAR
                      +D ++d+VG+E   +k+   L  d  + V  V I G  G GKTT AR
  gi|1232104   157    KDYEsDFVGLEVNVKKLVGYL-VDE-ENVQVVSITGMGGLGKTTLAR 201  

                   ALfs..qLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsy
                     f+++        ++F   a +  + +          +tr+   +    
  gi|1232104   202 QVFNheDVK-----HQFDRLAWVCVSQE----------FTRK---NV--- 230  

                   GmKLhLQeqfLS.....kILnqkDikIhdHLGvieERLkdqKVLIiLDDV
                    ++  LQ+ + S++++++IL ++  + hd    + + L   K LI+ DD+
  gi|1232104   231 -WQMILQN-LTSrekkdEILQMEEAELHD---KLFQLLETSKSLIVFDDI 275  

                   ...DdleQLdAL..AketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVg
                    +++d ++ + + + +       G  +  T ++       +I++      
  gi|1232104   276 wkdEDWDLIKPIfpPN------KGWKVLLTSQNESVAVRGDIKYL----N 315  

                   fPSkeeALq....IFCrsAFgQnsPpd.....GFeeLeAreVtkLaGnLP
                   f  + +A +++ + F r AF ++ + +++ ++  e+   ++  k++G LP
  gi|1232104   316 FKPECLAIEdswtLFQRIAFPKKDASEskvdeEMEDM-GKQMLKHCGGLP 364  

                   LGLrVlGSsLR.GkskeeWedmLpRL......rtsfgnsLDgkIekvLrv
                   L+ +VlG  L    + ++We++   ++++  +rts   s +  I  vL  
  gi|1232104   365 LAIKVLGGLLAaKYTMHDWERLSVNIgsdivgRTS---SNNSSIYHVLSM 411  

                   sYDgLhekDqaLFLhIACfFN..gekvdyVkalLadsnnLDVrqGLkvLa
                   s+++L +  +  FL+ A f  +++ +v+++    a+ +            
  gi|1232104   412 SFEELPSYLKHCFLYLAHFPEdhKINVEKLSYCWAAEG------------ 449  

                   dKSLIhisplgnedkvdgtieMHnLLqqLGReAIVrk..QsidhdePgKR
                       I+  +   +                  e  ++  +Qs   +e   R
  gi|1232104   450 ----ISTAEDYHN-----------------GE-TIQDvgQSY-LEELVRR 476  

                   qFLvDaeeIcdVLtdnTGtgtrsVlGIslDtseieeelnIsekAFegMrN
                      +  +       d+T ++        + t+ +    ++ e  + +   
  gi|1232104   477 NMIIWER-------DATASR--------FGTCHLH-D-MMREVCLFKAKE 509  

                   LqFLriykksfrddgk<-*
                     FL i  ks + +     
  gi|1232104   510 ENFLQIAVKSVGVTSS    525  

gi|13937098|gb|AAK50048.1|AF363803_1: domain 1 of 1, from 6 to 168: score -169.3, E = 0.00062
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      r F  lV                + ++V                   
  gi|1393709     6    RQFARLV----------------Y-EAV------------------- 16   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                         +    ++F ls+F en+r+           + ++gl        
  gi|1393709    17 ------K----EKFKLSCFLENIRE----------LSKTNGLV------- 39   

                   LhLQeqfLSkILnqkDikIhdHL....GvieERLkdqKVLIiLDDVDdle
                    h Q++ LS  Ln      + +L +++  i + L ++KVL++LDDV d+ 
  gi|1393709    40 -HIQKEILSH-LNVRSNDFC-NLydgkKIIANSLSNKKVLLVLDDVSDIS 86   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   QL+ L ++ +WFGpGSR I+TT Dk+LLk +g++ t Y+     + eALq
  gi|1393709    87 QLENLGGKREWFGPGSRLIITTRDKHLLKTYGVDMT-YKARGLAQNEALQ 135  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    FC+ AF+Q++P++G+ +L ++ V++ a  LP                  
  gi|1393709   136 LFCLKAFKQDQPKEGYLNL-CKGVVEYARGLP------------------ 166  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                                                                     
  gi|1393709     - -------------------------------------------------- -    

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                                                                     
  gi|1393709   167 ------------------------------F------------------- 167  

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                        A                                            
  gi|1393709   168 -----A-------------------------------------------- 168  

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                           
  gi|1393709     - -------------------------------------    -    

gi|11278006|pir||T51186: domain 1 of 1, from 161 to 516: score -169.7, E = 0.00065
                   *->rDFddlVGiEaHlek.mksLLcLdskdeVrMVGIwGPaGIGKTTIAR
                         +  VG+ +  +  ++ LL+ d k  + ++ I G  G GKT  AR
  gi|1127800   161    ---EVVVGLADDAKIlLEKLLDYDEK-NRFIISIFGMGGLGKTALAR 203  

                   ALfs..qLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsy
                    L++++        ++F+ +a  + ++  y+  +i  +  ++++l   s 
  gi|1127800   204 KLYNsgDVK-----RRFEYRAWTY-VSQEYKTGDILMR--IIKSLGMTS- 244  

                   GmKLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDV.....
                   G  L   ++f       + +++      +   L  +K L++ DD+ +++ 
  gi|1127800   245 GEELEKIRMF-----AEEELEVY-----LHGLLEGKKYLVVVDDIwerea 284  

                   .DdleQLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIY..eVgfP
                    + l+   AL    +    GSR+I+TT  k   +  +    +Y ++  f 
  gi|1127800   285 wESLK--RALPCNHE----GSRVIITTRIKAVAEGLD-GR-FYahKLRFL 326  

                   SkeeALqIFCrsAFgQnsPp.dGFeeLeAreVtkLaGnLPLGLrVlGSsL
                   + ee  + F + AF+  + ++++  +   +e +  +  LPL+  Vl   L
  gi|1127800   327 TFEESWELFEQRAFRNIQRKdEDLLKT-GKEMVQKCRGLPLCIVVLAGLL 375  

                   RGkskeeWedmLpRLrtsfgnsL.DgkIekvLrv...sYDgLhekDqaLF
                    +k+  eW d+   L      +L+D+ I     v + s+ +L ++ +  F
  gi|1127800   376 SRKTPSEWNDVCNSLWR----RLkDDSIHVAPIVfdlSFKELRHESKLCF 421  

                   LhIACfFN.gekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgned
                   L+  +f  ++e+  ++++l+              L+    I+ ++     
  gi|1127800   422 LYLSIFPEdYEI--DLEKLIR------------LLVAEGFIQGDE----- 452  

                   kvdgtieMHnLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdn
                         eM  + + ++R  I  ++ id      R  L   +         
  gi|1127800   453 ------EM--MMEDVARYYI--EELID------RSLLEAVR--------- 477  

                   TGtgtrsVlGIslDtseieeelnIsekAFegMrNLqFLriykksfrddgk
                      g  +V+      ++i +     + A ++   L F ++y++    +++
  gi|1127800   478 RERG--KVM-----SCRIHDL--LRDVAIKKSKELNFVNVYND--HVSQH 516  

                   <-*
                      
  gi|1127800     -     -    

gi|13377505|gb|AAK20742.1|: domain 1 of 1, from 162 to 568: score -169.9, E = 0.00067
                   *->rDFddlVGiEaHlekmksLL.........cLdskdeVrMVGIwGPaG
                      rD +dlVGiE    k+   L+++ ++++++L+     +   +wG +G
  gi|1337750   162    RD-EDLVGIEENKGKLVKWLtpgaggdgdDLEQ-SSSKVTTVWGMPG 206  

                   IGKTTIARALfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpag
                   +GKTT A   +          +F  +a ++ +++sy             +
  gi|1337750   207 VGKTTLAAHVYRTVK-----LDFDATAWVT-VSESY-------------C 237  

                   lDeYsyGmKLhLQeqfLSkILnqkDikIhdHLGv........ieERLkdq
                   l +            +L kI    D++++    v+ ++  ++i + L+ +
  gi|1337750   238 LED------------LLKKIATAFDVEVD-VANVemrglaesIHDHLQGK 274  

                   KVLIiLDDVDd....leQLdALAketqWFGpGSRIIVTTeDkqL....Lk
                   K  ++LDDV  +   +e   +    +++ G   R ++T    + ++   +
  gi|1337750   275 KYILVLDDVWTplvwSEIRNVFPT-SNCIG---RFVITSRKYEVsrlaTR 320  

                   aHgInhtIYeVgfPSkeeALqIFCrsAF....gQnsPpdGFeeLeAreVt
                    H I ++    +          FC  AF ++  Q  Pp+  +eL A +++
  gi|1337750   321 EHAIHLQ--PLK---ARNSWVLFCKGAFwndvDQRCPPEL-QEL-ASKFI 363  

                   kLaGnLPLGLrVlGSsLRG..kskeeWedmLpRLrtsfgnsLDgkIek..
                     +  LP + +  G  L  ++ +  eWe++ + L +     L  +++ + 
  gi|1337750   364 AKCQGLPIAISCIGRLLSCkpQTPAEWENVYRGLDS----QLAKDVMPda 409  

                   ..vLrvsYDgLhekDqaLFLhIACfFN.g..ekvdyVkalLadsnnL...
                   + +L+vs ++L    +  FLh A    ++  + +++  +++a+  + +++
  gi|1337750   410 hmILKVSLEDLPYDLKNCFLHCALSPEdYvlQRRKTMRQWIAAG-FIret 458  

                   .......DVrqG.LkvLadKSLIhisplgned.kvdgtieMHnLLqqLGR
                   +++++ + V  G L  L+++SL ++  ++n+ ++  ++++MH+  + L+ 
  gi|1337750   459 desktleEVAEGyLVELVNRSLLQVV-ERNYAgR-LKWCRMHDVIRLLAL 506  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtse
                        +++++                  V +   Gt+  sV G     ++
  gi|1337750   507 N-KAKEECFG-----------------KVYNGSGGTRAFSVEG----ARR 534  

                   ieeel..nIsekAFegMrNLqFLriykksfrddgk<-*
                   i+ +l++nI+  ++ g + L+ L++++k+   d     
  gi|1337750   535 IS-VLggNIEQLSLSGTTQLRALHVFEKYINVDLL    568  

gi|10998939|gb|AAG26078.1|AC069299_4: domain 1 of 1, from 161 to 477: score -170.0, E = 0.00068
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIA..
                       D +    +E   +k k +      d     GI+G +G GKTT A +
  gi|1099893   161    SDPEIQTVLELGKKKVKEMMFKFT-DTH-LFGISGMSGSGKTTLAie 205  

                   .......RALf.sqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpa
                    +++++ R Lf+++              F + +r             +p 
  gi|1099893   206 lskdddvRGLFkNKVL------------FLTVSR-------------SP- 229  

                   glDeYsyGmKLhLQeqfLSkILnqkDikIhdHLGvieERLk...dqKVLI
                                         n ++++ +     i+E L ++ +q+ L+
  gi|1099893   230 ----------------------NFENLESC-----IREFLYdgvHQRKLV 252  

                   iLDDVDdleQLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVg
                   iLDDV   e Ld L  +++    GS   V+   k      +   t Y V+
  gi|1099893   253 ILDDVWTRESLDRLMSKIR----GSTTLVVSRSKLA----DPRTT-YNVE 293  

                   fPSkeeALqIFCrsAFgQnsPpdGFee.LeAreVtkLaGnLPLGLrVlGS
                   +  k+eA+  +C++AF Q+sPp  F++ L +++V+  +  LPL L+VlG 
  gi|1099893   294 LLKKDEAMSLLCLCAFEQKSPPSPFNKyL-VKQVVDECKGLPLSLKVLGA 342  

                   sLRGkskeeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLh
                   sL+ k + +We +  RL    g+  D+                       
  gi|1099893   343 SLKNKPERYWEGVVKRLLR--GEAADE----------------------- 367  

                   IACfFNgekvdyVkalLadsnnLDVrqGLkvLadK...SLIhisplgned
                           + ++V a+ ++s        L++L  K +++   +    +  
  gi|1099893   368 -------THESRVFAHMEES--------LENLDPKirdCFLDMGAFPE-- 400  

                   kvdgtieMHnLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdn
                     d+ i   +LL  +  e    ++ id           +    + VL  +
  gi|1099893   401 --DKKIPL-DLLTSVWVE----RHDID-----------EETAFSFVLRLA 432  

                   TGtgtrsVlGIslDtseiee..elnIs.ekAFegMrN.LqFLriykksfr
                     +         l + ++ + + ++I   ++F   ++ L+ L  +++ +r
  gi|1099893   433 DKNL--------LTIVNNPRfgDVHIGyYDVFVTQHDvLRDLALHMS-NR 473  

                   ddgk<-*
                    d +   
  gi|1099893   474 VDVN    477  

gi|5524754|emb|CAB50786.1|: domain 1 of 1, from 140 to 486: score -170.1, E = 0.00068
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         + +VG E   e+m   L      e   V I G  GIGKTT A  
  gi|5524754   140    ---NIMVGRENEFEMMLDQLARGG-RELEVVSIVGMGGIGKTTLATK 182  

                   Lfs..qLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyG
                   L+s++ +      s+F  +a  + ++                   eY   
  gi|5524754   183 LYSdpCIM-----SRFDIRAKAT-VS------------------QEYC-- 206  

                   mKLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDV......
                   +   L   +LS   +  D +  d    ++  Lk ++ L+++DD+ +++  
  gi|5524754   207 VRNVLLG-LLSLTSDEPDDQLAD---RLQKHLKGRRYLVVIDDIwtteaw 252  

                   DdleQLdALAketqWFGpGSRIIVTTeDkqLLka.......HgInhtIYe
                   Dd++    L     ++ +GSRI  TT + +  +  ++++++H   +    
  gi|5524754   253 DDIK----LCF-PDCY-NGSRILLTTRNVEVAEYassgkppHHMRLM--- 293  

                   VgfPSkeeALqIFCrsAFgQnsPp.dGFeeLeAreVtkLaGnLPLGLrVl
                         +e    ++   F +   ++  Fe++  ++++  +G LPL+  V 
  gi|5524754   294 ----NFDESWNLLHKKIFEKEGSYsPEFENI-GKQIALKCGGLPLAITVI 338  

                   GSsLR..GkskeeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqa
                      L + G   +eW ++     + +        + vL  sY  L ++ + 
  gi|5524754   339 AGLLSkmGQRLDEWQRIGENVSSVVSTDPEAQCMRVLALSYHHLPSHLKP 388  

                   LFLhIACfFN.gek..vdyVkalLadsnnLDVrqG..........LkvLa
                    FL+ A+f  +++++  ++V+ +  +  +L+ + G++ ++  ++  + L 
  gi|5524754   389 CFLYFAIFTEdEQIsvNELVELWPVEG-FLNEEEGksieevattcINELI 437  

                   dKSLIhisplgnedkvdgtieMHnLLqqLGReAIVrkQsidhdePgKRqF
                   d+SLI i + +                 +    I   +s           
  gi|5524754   438 DRSLIFIHNFS-----------------FRGT-I---ES----------- 455  

                   LvDaeeIcdVLtdnTGtgtrsVlGIslDtseieeelnIsekAFegMrNLq
                                    g          ++ + +el+  e      rN  
  gi|5524754   456 ----------------CG----------MHDVTRELCLREA-----RNMN 474  

                   FLriykksfrddgk<-*
                   F ++ +   ++d++   
  gi|5524754   475 FVNVIRG--KSDQN    486  

gi|8778651|gb|AAF79659.1|AC025416_33: domain 1 of 1, from 1052 to 1452: score -171.1, E = 0.00077
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                           +VG E  le+    L  d  de  +VG +G  G+GKTT    
  gi|8778651  1052    -----IVGQETMLERVWTRLTEDG-DE--IVGLYGMGGVGKTTLLTR 1090 

                   LfsqLSerhFq.ssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGm
                     +++Se   + s F   + +  ++           ++ ++ +     G 
  gi|8778651  1091 INNKFSE---KcSGFGVVIWVVVSK-----------SPDIHRIQGD-IGK 1125 

                   KLhLQeqfLSkIL.nqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQL
                    L L  +    + +nq  + I  +       L  qK  + LDD+   + L
  gi|8778651  1126 RLDLGGEEWDNVNeNQRALDIY-NV------LGKQKFVLLLDDIWEKVNL 1168 

                   dALAketqWFGp......GSRIIVTTeDkqLLkaHgInhtIYeVgfPSke
                   ++L        p +++++G  ++ TT  +      ++++   eV+  + e
  gi|8778651  1169 EVLGV------PypsrqnGCKVVFTTRSRDVCGRMRVDDP-MEVS--CLE 1209 

                   ..eALqIFCrsAFgQnsPp..dGFeeLeAreVtkLaGnLPLGLrVlGSsL
                   ++eA + F +   g+n+ +++ +  eL Ar+V+  +  LPL+L+V G  +
  gi|8778651  1210 pnEAWELFQMK-VGENTLKghPDIPEL-ARKVAGKCCGLPLALNVIGETM 1257 

                   R.GkskeeWedmLpRLrtsfgnsLDg..kIekvLrvsYDgLhek.DqaLF
                      +  +eW +++  L + +     g + I  +L+ sYD L++++ +  F
  gi|8778651  1258 AcKRMVQEWRNAIDVLSS-YAAEFPGmeQILPILKYSYDNLNKEqVKPCF 1306 

                   LhIACf...FNgekvdyVkalLadsnnLD........VrqGLk...vLad
                   L+   f+++ + ek  ++  ++ +  + D+++++++  +qG +  ++L+ 
  gi|8778651  1307 LYCSLFpedYRMEKERLIDYWICEG-FIDenesreraLSQGYEiigILVR 1355 

                   KSLIhisplgnedkvdgtieMHnLLqqLGReAIVrkQsidhdePgKRqFL
                    +L   +  +     ++ ++MH+  ++++   I  +   +  e  +R + 
  gi|8778651  1356 ACLLLEEAIN-----KEQVKMHDVVREMALW-I--ASDLG--EHKERCIV 1395 

                   ...vDaeeIcdVLtdnTGtgtrsVlGIslDtseieeelnIsekAFegMrN
                   + +v  +e   V +  +  +      +sl  +eie  l+ s + +e    
  gi|8778651  1396 qvgVGLREVPKVKNWSSVRR------MSLMENEIE-ILSGSPECLE--LT 1436 

                   LqFLriykksfrddgk<-*
                    +FL  ++++   + +   
  gi|8778651  1437 TLFLQKNDSLLHISDE    1452 

gi|7488666|pir||T08831: domain 1 of 1, from 1 to 168: score -171.3, E = 0.00079
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                +V           GKTT   A
  gi|7488666     1    -------------------------GGV-----------GKTTLVTA 11   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   Lf ++S      ++  ++F++ l             ++   +   s    
  gi|7488666    12 LFGKIS-----PQYDARCFIDDLN------------KYCGDFGATS---- 40   

                   LhLQeqfLSkILnqkDikIhdHLG....vieERLkdqKVLIiLDDVDdle
                      Q+q+L + Lnq +++Ih +L +++  ++ RL+  K LI+LD VD++e
  gi|7488666    41 --AQKQLLCQALNQGNMEIH-NLShgtmLVRTRLRRLKTLIVLDNVDQVE 87   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   QL+      +  G GSRII++ ++ ++Lk +g+   +Y V +  k+ ALq
  gi|7488666    88 QLENCLH-PEYLGEGSRIIIISKNMHILKNYGVYK-VYNVQLLKKDKALQ 135  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    +C  AF+ +    G+ee  ++ V k +  LPL                 
  gi|7488666   136 LLCKKAFKSDDIEKGYEEV-TYDVLKYVNGLPL----------------- 167  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                                                                     
  gi|7488666     - -------------------------------------------------- -    

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                                                                     
  gi|7488666     - -------------------------------------------------- -    

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                        A                                            
  gi|7488666   168 -----A-------------------------------------------- 168  

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                           
  gi|7488666     - -------------------------------------    -    

gi|7488661|pir||T08834: domain 1 of 1, from 1 to 167: score -172.0, E = 0.00086
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                +V           GKTT A A
  gi|7488661     1    -------------------------GGV-----------GKTTLAAA 11   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++ +      + F+  +F en+r           et+++    ++   +
  gi|7488661    12 VYNSIA-----DHFEALCFLENVR-----------ETSKK----HG--IQ 39   

                   LhLQeqfLSkIL.nqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLd
                    hLQ ++LS+  + +k i + +    i+ RL++qK L+iLDDVD+ eQL 
  gi|7488661    40 -HLQSNLLSETVgEHKLIGVKQGISIIQHRLQQQKILLILDDVDKREQLQ 88   

                   ALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFC
                   ALA+    FG GSR+I+TT DkqLL  Hg++ t YeV    +e+AL+ + 
  gi|7488661    89 ALAGRPDLFGLGSRVIITTRDKQLLACHGVERT-YEVNELNEEHALELLS 137  

                   rsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedm
                     AF+       +++   ++ ++ a  LPL                    
  gi|7488661   138 WKAFKLEKVDPFYKDV-LNRAATYASGLPL-------------------- 166  

                   LpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyV
                                                                     
  gi|7488661     - -------------------------------------------------- -    

                   kalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLG
                                                                     
  gi|7488661     - -------------------------------------------------- -    

                   ReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDts
                     A                                               
  gi|7488661   167 --A----------------------------------------------- 167  

                   eieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                        
  gi|7488661     - ----------------------------------    -    

gi|8809608|dbj|BAA97159.1|: domain 1 of 1, from 152 to 549: score -173.0, E = 0.00096
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      r     VG++  lek    L+ d     rM GI G  G+GKTT    
  gi|8809608   152    RLCQQTVGLDTTLEKTWESLRKDEN---RMLGIFGMGGVGKTTLLTL 195  

                   LfsqLSerhFqssFqlsaFmenlrgsysk.......eeigSgetrpaglD
                     +++ e +  +++   + +e ++    + + ++ +++ig +   +++ +
  gi|8809608   196 INNKFVEVS--DDYDVVIWVESSK----DadvgkiqDAIGER--LHICDN 237  

                   eYsyGmKLhLQeqfLSkILnqkDikIhdHLGvieERLkdqK...VLIiLD
                   + s     +          ++k  +I+         L+d+K++ VL+ LD
  gi|8809608   238 NWS--TYSR----------GKKASEIS-RV------LRDMKprfVLL-LD 267  

                   DVDdleQLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPS
                   D+   + L A+ + +   G    ++ TT  k      + n    eV   S
  gi|8809608   268 DLWEDVSLTAI-G-IPVLGKKYKVVFTTRSKDVCSVMRANED-IEVQCLS 314  

                   keeALqIFCrsAFgQnsPpdGFeeL..eAreVtkLaGnLPLGLrVlGSsL
                   + +A   F +     +   dG +e+++ A++++  +  LPL+L V    +
  gi|8809608   315 ENDAWDLFDM-----KVHCDGLNEIsdIAKKIVAKCCGLPLALEVIRKTM 359  

                   RGkske.eWedmLpRLrtsf...gnsLDgkIekvLrvsYDgLhekDqaLF
                     ks    W ++L  L++ ++++ ++    I  vL+ sYD L  k+   F
  gi|8809608   360 ASKSTViQWRRALDTLES-YrseMKGTEKGIFQVLKLSYDYLKTKNAKCF 408  

                   LhIACf....FNgekvdyVkalLadsnnLDVrqG...........LkvLa
                   L+ A f++    +++ ++V+ ++++  + D + G+++ ++++ +   +L+
  gi|8809608   409 LYCALFpkayYIKQD-ELVEYWIGEG-FIDEKDGrerakdrgyeiIDNLV 456  

                   dKSLIhisplgnedkvdgtieMHnLLqqLGReAIVrkQsidhdePgKRqF
                      L   s        ++ + MH++ + ++   IV +   d    g+R  
  gi|8809608   457 GAGLLLES--------NKKVYMHDMIRDMALW-IVSEFR-D----GERYV 492  

                   LvDaeeIcdVLtdnTGtgtrsVlGIslDtseieeelnIsekA.FegMrNL
                    v +      L d T+    +V  +sl  +ei+   nI ++ +F   +NL
  gi|8809608   493 -VKTDAGLSQLPDVTDWT--TVTKMSLFNNEIK---NIPDDPeFPDQTNL 536  

                   qFLriykksfrddgk<-*
                     L   ++  r       
  gi|8809608   537 VTLFLQNN--RLVDI    549  

gi|7488667|pir||T08832: domain 1 of 1, from 1 to 191: score -173.7, E = 0.0011
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                +V           GKTTIAR 
  gi|7488667     1    -------------------------GGV-----------GKTTIARK 11   

                   LfsqLSerhFqssFqlsaFmenlrgsysk.....................
                    +  +       +F  s+F en+r+  + ++  + +++ ++ + +   ++
  gi|7488667    12 VYEAIK-----GDFDVSCFLENIREVSKTnglvhiqkelsnlgvscflek 56   

                   ..........eeigSgetrpaglDeYsyGmKLhLQeqfLSkILnqkDikI
                    ++++  +  ee++  + r++ +D+                 L    + I
  gi|7488667    57 cktnglvpivEEVFRDQLRIVDFDN-----------------LHDGKMII 89   

                   hdHLGvieERLkdqKVLIiLDDVDdleQLdALAketqWFGpGSRIIVTTe
                           + L ++KVL++LDDV  l QL+ LA++ +WFGpGSR+I+TT 
  gi|7488667    90 A-------NSLSNKKVLLVLDDVSELSQLENLAGKQEWFGPGSRVIITTR 132  

                   DkqLLkaHgInhtIYeVgfPSkeeALqIFCrsAFgQnsPpdGFeeLeAre
                   Dk+LLk Hg+ +t  +     + eALq  C+ AF++++P+ G+ +L ++e
  gi|7488667   133 DKHLLKTHGVHLT-CKARALAQNEALQLICLKAFKRDQPKKGYLNL-CKE 180  

                   VtkLaGnLPLGLrVlGSsLRGkskeeWedmLpRLrtsfgnsLDgkIekvL
                    ++ a  LPL                                        
  gi|7488667   181 MIECARGLPL---------------------------------------- 190  

                   rvsYDgLhekDqaLFLhIACfFNgekvdyVkalLadsnnLDVrqGLkvLa
                                                                     
  gi|7488667     - -------------------------------------------------- -    

                   dKSLIhisplgnedkvdgtieMHnLLqqLGReAIVrkQsidhdePgKRqF
                                                   A                 
  gi|7488667   191 --------------------------------A----------------- 191  

                   LvDaeeIcdVLtdnTGtgtrsVlGIslDtseieeelnIsekAFegMrNLq
                                                                     
  gi|7488667     - -------------------------------------------------- -    

                   FLriykksfrddgk<-*
                                    
  gi|7488667     - --------------    -    

gi|9758302|dbj|BAB08845.1|: domain 1 of 1, from 155 to 572: score -173.9, E = 0.0011
                   *->rDFddlVGiEaHlekmksLL.....cLdskdeVrMVGIwGPaGIGKT
                                  + +m+ +L++  ++L   de  + G  G  G+GKT
  gi|9758302   155    ------------MVAMDPMLesawnRLME-DEIGILGLHGMGGVGKT 188  

                   TIARALfsqLSerhFq.ssFqlsaFmenlrgsyskeeigSgetrpaglDe
                   T      +++S     +  F   + +  +++++        +++    De
  gi|9758302   189 TLLSHINNRFSR---VgGEFDIVIWIVVSKELQI-------QRIQ---DE 225  

                   YsyGmKLh.....LQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiL
                        KL+++++++ ++        +Dik ++    i + Lk+++  + L
  gi|9758302   226 IW--EKLRsdnekWKQK-------TEDIKASN----IYNVLKHKRFVLLL 262  

                   DDV.DdleQLdALAketqWFGp...GSRIIVTTeDkqLLkaHgInhtIYe
                   DD+  ++++ ++ +     F ++++G  I+ TT  k++    g++    e
  gi|9758302   263 DDIwSKVDLTEVGVP----FPSrenGCKIVFTTRLKEICGRMGVDSD-ME 307  

                   VgfPSkeeALqIFCrsAFgQnsP..pdGFeeLeAreVtkLaGnLPLGLrV
                   V     ++A   F     g+ + +++       Ar V+k +  LPL+L+V
  gi|9758302   308 VRCLAPDDAWDLFTKK-VGEITLgsHPEIPTV-ARTVAKKCRGLPLALNV 355  

                   lGSsLR.GkskeeWedmLpRLrtsfg..nsLDgkIekvLrvsYDgLhek.
                    G  +   ++ +eW  ++  L +s  +  +  ++I  +L+ sYD L +++
  gi|9758302   356 IGETMAyKRTVQEWRSAIDVLTSSAAefSGMEDEILPILKYSYDNLKSEq 405  

                   DqaLFLhIACf...FNgekvdyVkalLadsnnLDVrqG.........Lkv
                    +  F + A f+++ N ek d+V  ++++  + D + G+ ++++ +   +
  gi|9758302   406 LKLCFQYCALFpedHNIEKNDLVDYWIGEG-FIDRNKGkaenqgyeiIGI 454  

                   LadKSLIhisplgnedkvdgtieMHnLLqqLGReAIVrk...........
                   L+  +L   ++       ++t++MH+  ++++   I    ++++++   +
  gi|9758302   455 LVRSCLLMEEN-------QETVKMHDVVREMALW-IASDfgkqkenfivq 496  

                   ...QsidhdePgKRqF.....Lv..DaeeIcdVLtdnTGtgtrsVlGIsl
                    + Qs    e +K++  ++ +L+ ++ e I+d  +            I l
  gi|9758302   497 aglQSRNIPEIEKWKVarrvsLMfnNIESIRDAPESPQL--------ITL 538  

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                    ++++    +Is + F+ M+ L  L   ++  rd  +   
  gi|9758302   539 LLRKNF-LGHISSSFFRLMPMLVVLDLSMN--RDLRH    572  

gi|8118179|gb|AAF72926.1|: domain 1 of 1, from 2 to 156: score -174.3, E = 0.0011
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                               ++V                   
  gi|8118179     2    -----------------------A-QAV------------------- 5    

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++ +      ++F+ ++F  n+r                ++D ++    
  gi|8118179     6 -YNSIA-----KQFECKCFLHNVR---------------ENSDKHG---L 31   

                   LhLQeqfLSk.I.....LnqkDikIhdHLGvieERLkdqKVLIiLDDVDd
                     LQeq+LS++I+ ++++++ +  I+     i+ RL+++KVL+iLDDV++
  gi|8118179    32 IYLQEQLLSEsIgfkepFGHVNEGIP----IIRRRLCQKKVLLILDDVNK 77   

                   leQLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeA
                   l+QL +L++e + FG+GSR+I+TT Dk+LL +HgI+  IYeV+       
  gi|8118179    78 LKQLQVLVGEPSSFGHGSRVIITTRDKHLLSSHGIKK-IYEVD------- 119  

                   LqIFCrsAFgQnsPpdGFeeL.eAreVtkLaGnLPLGLrVlGSsLRGksk
                                   G   L+e                           
  gi|8118179   120 ----------------G---LnE--------------------------- 123  

                   eeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNg
                      e +L  Lrt        k                       A+  N+
  gi|8118179   124 ---EQALELLRT--------K-----------------------AFKSNK 139  

                   ekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHn
                    +          s                                     
  gi|8118179   140 ND----------S------------------------------------- 142  

                   LLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlG
                         R                                           
  gi|8118179   143 ------RY------------------------------------------ 144  

                   IslDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                           +   +I  +A +          y +          
  gi|8118179   145 --------D---YILNRAIK----------YAS-------    156  

gi|7489235|pir||T07772: domain 1 of 1, from 2 to 153: score -174.5, E = 0.0012
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      rD                   +ds                       
  gi|7489235     2    RDI------------------FDS----------------------- 7    

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                       +S     ++F+  +F+ n+++++            a l        
  gi|7489235     8 ----IS-----HQFEGACFVVNVKENQ------------AKLGL------ 30   

                   LhLQeqfLSkILnqkDikIhdHLG...vieERLkdqKVLIiLDDVDdleQ
                   L+LQ+ + Sk+L  + + I d  G+ + i+ RL  +KVL++LDDVD+++Q
  gi|7489235    31 LSLQKTLVSKVLTVESVNIADEYGgidMIRKRLGSKKVLVVLDDVDHQDQ 80   

                   LdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqI
                   Ld LA+  +WFG GSRII+T  Dk+L++ +  + t Y Vg+  + eA q 
  gi|7489235    81 LDGLAGHRNWFGRGSRIIITARDKHLFRDY--DGT-YSVGLLAEAEAIQL 127  

                   FCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWe
                   F  +AF+++sP  +F++L +++V+                          
  gi|7489235   128 FSWHAFRKTSPNSDFQQL-SQRVAQY------------------------ 152  

                   dmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvd
                                                                     
  gi|7489235     - -------------------------------------------------- -    

                   yVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqq
                                                                     
  gi|7489235     - -------------------------------------------------- -    

                   LGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslD
                       A                                             
  gi|7489235   153 ----A--------------------------------------------- 153  

                   tseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                          
  gi|7489235     - ------------------------------------    -    

gi|13872900|dbj|BAB44007.1|: domain 1 of 1, from 171 to 558: score -174.9, E = 0.0012
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      r  dd+V      +++ s    +s   V   GI G  GIGKTT A  
  gi|1387290   171    RAIDDIV------KMIVSSNYNESRSTV--FGIQGMGGIGKTTLAQK 209  

                   Lfs..qLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyG
                    ++++++      ++Fq ++    ++ +y           + +l      
  gi|1387290   210 IYNeqRIR-----EKFQVHIWLC-ISQNY----------TETSLLKQA-- 241  

                   mKLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQL
                          ++   I +q   k +  L  + +  + + V+++LDDV ++++ 
  gi|1387290   242 ------IRMAGGICDQLETKTE-LLPLLVDTIRGKSVFLVLDDVWKSDVW 284  

                   dALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIF
                     L       G  S I VT  +   L      +t  +V    + + L+ +
  gi|1387290   285 IDLLRLPFLRGLNSHILVTSRNLDVLVEMHATYT-HKVNKMNDCDGLELL 333  

                   CrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLR.GkskeeWe
                        g       F     ++++k ++ LPL+ +V+   L + ++  eWe
  gi|1387290   334 MKMSLGPYEQSREFSGV-GYQIVKKCDGLPLAIKVVAGVLStKRTRAEWE 382  

                   dmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACf.FN.gek
                    +     +   ++L ++    L  sY  L  + +  FL  A ++ N    
  gi|1387290   383 SIRDSKWS--IHGLPRELGGPLYLSYSNLPPELKQCFLWCALLpSNfVIR 430  

                   vdyVkalLadsnnLDVrqGLkv..........LadKSLIhisplgnedkv
                   +d V  +  + +++   +G  +++  ++  ++L  + L + +p+  +   
  gi|1387290   431 RDAVAYWWVAEGFVTEVHGYSIhevaeeyyheLIRRNLLQPRPEFVD--- 477  

                   dgtieMHnLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTG
                   +g   MH+LL+ LG       +si   + +  + L + +  c   +++  
  gi|1387290   478 KGESTMHDLLRSLGQF-LTKDHSI-FMNMEYSKALPNLRHLC--ISNDVE 523  

                   tgtrsVlGIslDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-
                    +          +  ie++ +   +++    N  F +i+k++fr  ++  
  gi|1387290   524 -E----------IPAIEKQKCL--RSLLVFDNKNFMKINKDIFRELKH   558  

                   *
                    
  gi|1387290     -   -    

gi|3309620|gb|AAC26126.1|: domain 1 of 1, from 157 to 578: score -174.9, E = 0.0012
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                           +VG E  lek     +L   d+  + G +G  G+GKTT    
  gi|3309620   157    -----IVGQEIMLEKAWN--RLME-DGSGILGLYGMGGVGKTTLLTK 195  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                     +++S  + +++F   + +  +r         S+  r++  D      K
  gi|3309620   196 INNKFS--KIDDRFDVVIWVVVSR---------SSTVRKIQRDIA---EK 231  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                     L  +  S+   ++D +I      i + L+ +K  + LDD+   + L+A
  gi|3309620   232 VGLGGMEWSE---KNDNQIA-VD--IHNVLRRRKFVLLLDDIWEKVNLKA 275  

                   LA......ketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeA
                      + ++++      +G  +  TT  +      g+++   eV+    ee 
  gi|3309620   276 VGvpypskD------NGCKVAFTTRSRDVCGRMGVDDP-MEVSCLQPEES 318  

                   LqIFCrsAFgQnsP..pdGFeeLeAreVtkLaGnLPLGLrVlGSsLR.Gk
                      F +   g+n+ +++ +   L Ar+V++ +  LPL+L+V G ++   +
  gi|3309620   319 WDLFQMK-VGKNTLgsHPDIPGL-ARKVARKCRGLPLALNVIGEAMAcKR 366  

                   skeeWedmLpRLrtsfgnsLD.....gkIekvLrvsYDgLhek.DqaLFL
                   + +eW  ++  L +s    +D ++ +++I  vL+ sYD L+ +  ++ FL
  gi|3309620   367 TVHEWCHAIDVLTSS---AIDfsgmeDEILHVLKYSYDNLNGElMKSCFL 413  

                   hIACfFN.gekvd..yVkalLadsnnL........DVrqGLkv...LadK
                   +   f  ++ ++++++V  ++ +  + +++++++++++qG ++ ++L+  
  gi|3309620   414 YCSLFPEdYLIDKegLVDYWISEG-FInekegrerNINQGYEIigtLVRA 462  

                   SLIhisplgnedkvdgtieMHnLLqqLGReAIVrk...............
                   +L   ++ +     +  ++MH+  ++++   I    ++++++   + + +
  gi|3309620   463 CLLLEEERN-----KSNVKMHDVVREMALW-ISSDlgkqkekcivragvg 506  

                   .....QsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslD...t
                    ++ ++ +d      R++    +eI ++++ +            l +  +
  gi|3309620   507 lrevpKVKD--WNTVRKISLMNNEIEEIFDSHECAA--------LTtlfL 546  

                   seieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                    +++ ++ Is + F+ M+ L  L   ++  ++ ++   
  gi|3309620   547 QKND-VVKISAEFFRCMPHLVVLDLSEN--QSLNE    578  

gi|11990497|gb|AAG42167.1|AF149112_1: domain 1 of 1, from 164 to 567: score -175.2, E = 0.0012
                   *->rDFddlVGiEaHlekmksLLcLdskdeV.....rMVGIwGPaGIGKT
                      +  ++l+G +     +  +L  +  deV +++ +MV I G  G GKT
  gi|1199049   164    KKAEELIGTKEKSLDIVKMLT-EG-DEVfkkhlKMVSIVGFGGLGKT 208  

                   TIARALfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeY
                   T A + + +L       +F   aF++ ++                   + 
  gi|1199049   209 TLANVVYEKLR-----GDFDCAAFVS-VS------------------LNP 234  

                   syGmKLhLQeqfLSkIL..nqkDik..........IhdHLGvieERLkdq
                   +  mK  L + +L ++ ++  k+i++++  ++++ I++    i++ L+d+
  gi|1199049   235 D--MK-KLFKCLLHQLDkgEYKNIMdesawsetqlISE----IRDFLRDK 277  

                   KVLIiLDDV......DdleQLdALAketqWFGpGSRIIVTTeDkqLLkaH
                   + +I +DD+ +++  +++    AL    +   +GSR+I TT  + L  a 
  gi|1199049   278 RYFILIDDIwdksvwNNIR--CALIE-NE---CGSRVIATT--RILDVAK 319  

                   gInhtIYeVgfPSkeeALqIFCrsAF..gQnsPpdGFeeLeAreVtkLaG
                   ++   +Y+ +  S+ +  q F +  F+ g + Pp    e  ++++   +G
  gi|1199049   320 EVGG-VYQLKPLSTSDSRQLFYQRIFgiGDKRPPIQLAEV-SEKILGKCG 367  

                   nLPLGLrVlGSsLRGkskee.....Wed....mLpRLrtsfgnsLDgkIe
                     PL+   l S L Gk+++e++ + W +  ++m   L++    +L  +  
  gi|1199049   368 GVPLAIITLASMLAGKKEHEntytyWYKvyqsMGSGLEN--NPGL-MDMR 414  

                   kvLrvsYDgLhekDqaLFLhIACf...FNgekvdyVkalLadsnnLDVrq
                    +L vsY +L  + +   L+    +++ N e+ +++ +++++  +   +q
  gi|1199049   415 RILHVSYYDLPPNLKTCLLYLSLYpedYNIETKELIWKWIGEG-FIHEEQ 463  

                   G..........LkvLadKSLIhisplgnedkvdgtieMHnLLqqLGReAI
                   G++  + +++    L +KSL++    + ++k    ++ H++   L     
  gi|1199049   464 GkslyevgedyIAELINKSLVQPMYINIANK-ASSVRVHDMVLDLITS-- 510  

                   VrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtseiee
                     ++++         FL            +  t+       sl  s+i  
  gi|1199049   511 LSNEEN---------FLATLG--------GQQTR-------SLP-SKIR- 534  

                   elnI...sekAFegMrNLqFLriykksfrddgk<-*
                    l+ ++++e+  + M+    L+  ++++ +++    
  gi|1199049   535 RLSLqssNEEDVQPMPTMSSLSHVRSLTVFSKD    567  

gi|2129652|pir||S71195: domain 1 of 1, from 207 to 626: score -175.8, E = 0.0013
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                       D    VG+E   +k+k  L   ++ +  +    G  G GKTTIA  
  gi|2129652   207    YDHTQVVGLEGDKRKIKEWLFRSNDSQLLIMAFVGMGGLGKTTIAQE 253  

                   Lfs..qLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyG
                    f+++ +      ++F+ ++ ++ ++ +  +e+i    ++  +l + s  
  gi|2129652   254 VFNdkEIE-----HRFERRIWVS-VSQTFTEEQIMR--SILRNLGDAS-- 293  

                   mKLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDV......
                                   +Di     L  i++ L  ++ LI+ DDV +++ +
  gi|2129652   294 --------------VGDDIGTL--LRKIQQYLLGKRYLIVMDDVwdknls 327  

                   ..DdleQLdALAketqWFGpGSRIIVTTeDkqLLkaHgInh..tIYeVgf
                     D++ Q   L       G G  +IVTT      k     +++t    ++
  gi|2129652   328 wwDKIYQ--GLPR-----GQGGSVIVTTRSESVAKRVQARDdkT-HRPEL 369  

                   PSkeeALqIFCrsAFgQn...sPpdGFeeLeAreVtkLaGnLPLGLrVlG
                    S +     FC  AF  n+++  +   e+   +e+++ +  LPL  + +G
  gi|2129652   370 LSPDNSWLLFCNVAFAANdgtCERPELEDV-GKEIVTKCKGLPLTIKAVG 418  

                   SsLRGks..keeWedmLpRLrtsfgnsLDgk......IekvLrvsYDgLh
                     L  k++  +eW ++   ++      L g++++++++++ L+ sYD+L 
  gi|2129652   419 GLLLCKDhvYHEWRRIAEHFQD----ELRGNtsetdnVMSSLQLSYDELP 464  

                   ekDqaLFLhIACfFN.gek..vdyVkalLadsnnLDVrqG..........
                   ++ ++  L       ++ +++  +V+ ++++  ++  r+G++ ++++++ 
  gi|2129652   465 SHLKSCILTLSLYPEdCVIpkQQLVHGWIGEG-FVMWRNGrsatesgedc 513  

                   LkvLadKSLIhisplgnedkvdgtieMHnLLqqLGReAIVrk........
                   +  L++++LI + ++ ++  +  t++ H++ + L  + I  k++ +++++
  gi|2129652   514 FSGLTNRCLIEVVDK-TYSGTIITCKIHDMVRDLVID-IAKKdsfsnpeg 561  

                   .......QsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDts
                    + ++ + s    +  + q+ v+ +  + V +  +  +          ++
  gi|2129652   562 lncrhlgIS---GNFDEKQIKVNHK-LRGVVSTTKTGE----------VN 597  

                   eieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   +++   +   k F     L+ L i k+  ++d +   
  gi|2129652   598 KLN---SDLAKKFTDCKYLRVLDISKS--IFDAP    626  

gi|7484911|pir||T08416: domain 1 of 1, from 155 to 574: score -175.8, E = 0.0013
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                       D    VG+E   +k+k  L   ++ +  +    G  G GKTTIA  
  gi|7484911   155    YDHTQVVGLEGDKRKIKEWLFRSNDSQLLIMAFVGMGGLGKTTIAQE 201  

                   Lfs..qLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyG
                    f+++ +      ++F+ ++ ++ ++ +  +e+i    ++  +l + s  
  gi|7484911   202 VFNdkEIE-----HRFERRIWVS-VSQTFTEEQIMR--SILRNLGDAS-- 241  

                   mKLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDV......
                                   +Di     L  i++ L  ++ LI+ DDV +++ +
  gi|7484911   242 --------------VGDDIGTL--LRKIQQYLLGKRYLIVMDDVwdknls 275  

                   ..DdleQLdALAketqWFGpGSRIIVTTeDkqLLkaHgInh..tIYeVgf
                     D++ Q   L       G G  +IVTT      k     +++t    ++
  gi|7484911   276 wwDKIYQ--GLPR-----GQGGSVIVTTRSESVAKRVQARDdkT-HRPEL 317  

                   PSkeeALqIFCrsAFgQn...sPpdGFeeLeAreVtkLaGnLPLGLrVlG
                    S +     FC  AF  n+++  +   e+   +e+++ +  LPL  + +G
  gi|7484911   318 LSPDNSWLLFCNVAFAANdgtCERPELEDV-GKEIVTKCKGLPLTIKAVG 366  

                   SsLRGks..keeWedmLpRLrtsfgnsLDgk......IekvLrvsYDgLh
                     L  k++  +eW ++   ++      L g++++++++++ L+ sYD+L 
  gi|7484911   367 GLLLCKDhvYHEWRRIAEHFQD----ELRGNtsetdnVMSSLQLSYDELP 412  

                   ekDqaLFLhIACfFN.gek..vdyVkalLadsnnLDVrqG..........
                   ++ ++  L       ++ +++  +V+ ++++  ++  r+G++ ++++++ 
  gi|7484911   413 SHLKSCILTLSLYPEdCVIpkQQLVHGWIGEG-FVMWRNGrsatesgedc 461  

                   LkvLadKSLIhisplgnedkvdgtieMHnLLqqLGReAIVrk........
                   +  L++++LI + ++ ++  +  t++ H++ + L  + I  k++ +++++
  gi|7484911   462 FSGLTNRCLIEVVDK-TYSGTIITCKIHDMVRDLVID-IAKKdsfsnpeg 509  

                   .......QsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDts
                    + ++ + s    +  + q+ v+ +  + V +  +  +          ++
  gi|7484911   510 lncrhlgIS---GNFDEKQIKVNHK-LRGVVSTTKTGE----------VN 545  

                   eieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   +++   +   k F     L+ L i k+  ++d +   
  gi|7484911   546 KLN---SDLAKKFTDCKYLRVLDISKS--IFDAP    574  

gi|5817343|gb|AAD52715.1|AF123699_1: domain 1 of 1, from 1 to 158: score -176.8, E = 0.0015
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                                 IA+A
  gi|5817343     1    -------------------------------------------IAKA 4    

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++ +      ++F+ + F  n+r                ++ e +   +
  gi|5817343     5 IYNEIG-----RNFEGRSFLANIR----------------EVWEQN-VGQ 32   

                   LhLQeqfLSkILnqkDikIhdHLG....vieERLkdqKVLIiLDDVDdle
                    +LQeq+L  I +    kI     +++  ++ERL++++ LI+LDDV+ l+
  gi|5817343    33 VNLQEQLLFDICKEMTTKIQ-SIDngkiILKERLCHKRILIVLDDVNTLD 81   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   QL AL +  +WFG+GSR+I+TT D+++L+  +++  +Ye     ++e  +
  gi|5817343    82 QLNALCGSHKWFGSGSRVIITTRDRHILRGNRVDQ-VYEMRNMDEKESIE 130  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    F  +AF+Q sP ++F  + ++ V++  G                     
  gi|5817343   131 LFSWHAFKQASPTEDFVGI-SKNVVEYSG--------------------- 158  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                                                                     
  gi|5817343     - -------------------------------------------------- -    

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                                                                     
  gi|5817343     - -------------------------------------------------- -    

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                                                                     
  gi|5817343     - -------------------------------------------------- -    

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                           
  gi|5817343     - -------------------------------------    -    

gi|13194660|gb|AAK15495.1|AF325684_1: domain 1 of 1, from 1 to 171: score -176.8, E = 0.0015
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                +V           GKTT A A
  gi|1319466     1    -------------------------GGV-----------GKTTLAVA 11   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++ +      + F+ s+F en+r           et+++          
  gi|1319466    12 VYNSIA-----DHFEASCFLENVR-----------ETSNKKGLQ------ 39   

                   LhLQeqfLSkILnqkDikIhdH....LGvieERLkdqKVLIiLDDVDdle
                    hLQ  +LSk  + k ik   + +++   i+  Lk +KVL+iLDDVD ++
  gi|1319466    40 -HLQSILLSKTVGEKKIKLT-NwregIHIIKRKLKEKKVLLILDDVDEQK 87   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   QL A+ +   WFG GSR+I+TT D +LL  H+++ t Y+V    +++ALq
  gi|1319466    88 QLQAIIGSPDWFGGGSRVIITTRDEHLLALHNVKIT-YKVRELNEKHALQ 136  

                   IFCrsAFg.QnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskee
                    + + AF  ++     + ++  ++ +  a  LPL+L              
  gi|1319466   137 LLSQKAFElEKEVDPSYHDI-LNRAVAYASGLPLAL-------------- 171  

                   WedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgek
                                                                     
  gi|1319466     - -------------------------------------------------- -    

                   vdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLL
                                                                     
  gi|1319466     - -------------------------------------------------- -    

                   qqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIs
                                                                     
  gi|1319466     - -------------------------------------------------- -    

                   lDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                            
  gi|1319466     - --------------------------------------    -    

gi|13872974|dbj|BAB44079.1|: domain 1 of 1, from 173 to 557: score -177.3, E = 0.0016
                   *->rDFddlVGiEaHlekmksLLc...LdskdeVrMVGIwGPaGIGKTTI
                      rD +++V         ++ L +++ +s +    + + G  G GKTT 
  gi|1387297   173    RDREEMV---------RLVLSdngHNS-CNLCVIPVVGMGGLGKTTL 209  

                   ARALf..sqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeY
                       +++++       + F l++ ++ ++                ++De 
  gi|1387297   210 MQMVYhdDRVR-----EHFDLRIWIY-VS---------------ESFDE- 237  

                   syGmKLhLQeqfLSkILnqkDikIhdHLGvieE....RLkdqKVLIiLDD
                       KL  Qe + +   +q  +    +   ++E+ ++ L+ ++ L++LDD
  gi|1387297   238 ---RKLT-QETLEASDYDQS-VAST-NMNMLQEtlsrVLRGKRYLLVLDD 281  

                   VDdleQLd.......ALAketqWFGpGSRIIVTTeDkqLLkaHg.InhtI
                   V + + Ld+ ++ + AL       G GS I+VT  +    +  g+I+   
  gi|1387297   282 VWNED-LDkwhsyraALIS----GGFGSKIVVTSRNENVGRIMGgIEP-- 324  

                   YeVgfPSkeeALqIFCrsAFg..QnsPpdGFeeLeAreVtkLaGnLPLGL
                   Y+    S+++    F  +AF+++  s++   e +   e++k    LPL+ 
  gi|1387297   325 YKLQKLSDDDSWSVFKSHAFRdgDCSAHPELEAI-GMEIVKKLKGLPLAS 373  

                   rVlGSsLR.GkskeeWedmLp....RLrtsfgnsLDgkIekvLrvsYDgL
                   + lGS L    ++eeW+d+L ++  +L          +I   Lr sY+ L
  gi|1387297   374 KALGSLLFcKTDEEEWKDILQndiwELPA-----DKNNILPALRLSYNHL 418  

                   hekDqaLFLhIAC.....fFNgekvdyVkalLadsnnL.........DVr
                     + +  F    + +++ +F+ ek  +Vk +La   + +++++++ +D  
  gi|1387297   419 PPHLKQCFAFCSVypkdyMFRREK--LVKIWLALG-FIrqsrkkrmeDTG 465  

                   qG.LkvLadKSLIhisplgnedkvdgtieMHnLLqqLGReAIVrkQsidh
                   +  ++ L  +S  +  +++         +MH+    L++  I  + + dh
  gi|1387297   466 NAyFNELLSRSFFQPYENN--------YVMHDAMHDLAKS-ISMEDC-DH 505  

                   dePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtseieeelnIsekA
                    ++g R+            ++++ t+       s+     +   +++ + 
  gi|1387297   506 LDYGRRH------------DNAIKTRH-----LSFPCKDAK---CMHFNP 535  

                   FegMrNLqFLriykksfrddgk<-*
                   + g r L+ L i   ++++  +   
  gi|1387297   536 LYGFRKLRTLTIIHGYKSRMSQ    557  

gi|8515762|gb|AAF76163.1|AF266747_1: domain 1 of 1, from 140 to 486: score -177.9, E = 0.0017
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         + +VG E   e+m   L      e   V I G  GIGKTT A  
  gi|8515762   140    ---NIMVGRENEFEMMLDQLARGG-RELEVVSIVGMGGIGKTTLAAK 182  

                   Lfs..qLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyG
                   L+s++ +      s+F  +a  + ++  y             ++ +    
  gi|8515762   183 LYSdpYIM-----SRFDIRAKAT-VSQEY-------------CVRN---- 209  

                   mKLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDV......
                   + L L    LS   +  D +  d    ++  Lk ++ L+++DD+ +++  
  gi|8515762   210 VFLGL----LSLTSDEPDDQLAD---RLQKHLKGRRYLVVIDDIwtteaw 252  

                   DdleQLdALAketqWFGpGSRIIVTTeDkqLLk........aHg.InhtI
                   Dd++    L     ++ +GSRI  TT + +  ++ ++++++ H +I +  
  gi|8515762   253 DDIK----LCF-PDCY-NGSRILLTTRNVEVAEnassgkppHHMrIMNF- 295  

                   YeVgfPSkeeALqIFCrsAFgQnsPp.dGFeeLeAreVtkLaGnLPLGLr
                           +e    ++   F     ++  Fe++  ++++  +G LPL+  
  gi|8515762   296 --------DESWNLLHKKIFETEGSYsPEFENI-GKQIALKCGGLPLAIT 336  

                   VlGSsLR..GkskeeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekD
                   V    L + G   + W ++     + +        + vL  sY  L ++ 
  gi|8515762   337 VIAGLLSkmGQRLDKWQRIAENVSSVVSTDPEAQCMRVLALSYHHLPSHL 386  

                   qaLFLhIACfFN..gekvdyVkalLadsnnLDVrqG..........LkvL
                   +  FL+ A+f  +++  v+++ +l a  ++L+ + G++ ++ +++  + L
  gi|8515762   387 KPCFLYFAIFAEdeEIYVNKLVDLWAVEGFLNEEEGksieevpetcINEL 436  

                   adKSLIhisplgnedkvdgtieMHnLLqqLGReAIVrkQsidhdePgKRq
                   +d+SLI+i +l                            s+         
  gi|8515762   437 VDRSLISIHNL----------------------------SF--------- 449  

                   FLvDaeeIcdVLtdnTGtgtrsVlGIslDtseieeelnIsekAFegMrNL
                                d++  ++        +++ + +el+  e      rN 
  gi|8515762   450 -------------DGKIERC--------EMHDVTRELCLREA-----RNM 473  

                   qFLriykksfrddgk<-*
                    F ++ +    +d++   
  gi|8515762   474 NFVNVIRG--NSDQN    486  

gi|13937086|gb|AAK50042.1|AF363797_1: domain 1 of 1, from 1 to 169: score -178.2, E = 0.0018
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                ++           GKTT A  
  gi|1393708     1    -------------------------GGM-----------GKTTLANT 11   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   Lf  +S      ++   + ++ l+++y              l   s    
  gi|1393708    12 LFKEIS-----PQYDAWCHIDDLSKIY------------LDLGVTS---- 40   

                   LhLQeqfLSkILnqkDikIhdHLG....vieERLkdqKVLIiLDDVDdle
                      Q+q+L ++Lnq +++Ih H  +++  +++RL++ K LI+LD VD++e
  gi|1393708    41 --AQKQLLCQVLNQGNMEIH-HVShgtmLMKNRLRHLKTLIVLDNVDQVE 87   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   QL+ L    +  G GSRII++  D  +L+ +g+n  +Y V+   +  AL+
  gi|1393708    88 QLEKLGLHPEYLGAGSRIIIISTDCRILQNYGVNE-VYNVKVLDETQALK 136  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    FC  AF+ +  p  +eeL ++ V k +  LPL                 
  gi|1393708   137 LFCKRAFKSKDIPKEYEEL-TFDVLKYVKGLPL----------------- 168  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                                                                     
  gi|1393708     - -------------------------------------------------- -    

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                                                                     
  gi|1393708     - -------------------------------------------------- -    

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                        A                                            
  gi|1393708   169 -----A-------------------------------------------- 169  

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                           
  gi|1393708     - -------------------------------------    -    

gi|7415941|dbj|BAA93618.1|: domain 1 of 1, from 427 to 820: score -178.7, E = 0.0019
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      r    l+G +        LL   +   +  + +wG  GIGKTT  + 
  gi|7415941   427    RSTTQLIGRGKEKDDVIKLLSDCN-PIRQVISVWGMGGIGKTTLVKS 472  

                   LfsqLSerhFq.ssFqlsaFmenlrgsysk................eeig
                    + q S  + ++  F+ +a ++ lr  +  +  ++  ++  ++++++ + 
  gi|7415941   473 IY-QSS--ELEkLGFERRAWVTVLRPFQLTellrslaqrlvkdspgKKVE 519  

                   SgetrpaglDeYsyGmKLhLQeqfLSkILnqkDikIhdHLGvieERLkdq
                   S   +p gl   +           LS +   +   I+  L   ++ L  +
  gi|7415941   520 S---IP-GLARSG-----------LSTMGSEE--LID-KL---KQDLTGK 548  

                   KVLIiLDDV......DdleQLdALAketqWFGpGSRIIVTTeDkqL....
                   K LI+LDD++++++ D +     + +      +GSRII TT  k   ++ 
  gi|7415941   549 KYLIVLDDLstttewDSIIRNLPINN------NGSRIILTTRFKLVaqhc 592  

                   ....LkaHgInhtIYeVgfPSkeeALqIF...CrsAFgQnsPpdGFeeLe
                   +++++  H+I+         ++++AL+ F ++ r    ++  + + +e  
  gi|7415941   593 skkeMNMHNIEGL-------TDGDALELFltkVRMDGDESELKPDLKEE- 634  

                   AreVtkLaGnLPLGLrVlGSsLR.G.kskeeWedmLpRLrtsfgn..sLD
                   A+ ++k +G LPL+   +G  L  ++++  eW +   R+  +f n++sL 
  gi|7415941   635 AKIIIKKCGRLPLAVATVGGFLSaRpRNIIEWREFSDRISEEFDNnpSL- 683  

                   gkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVkalL.........
                   + I k+L  sY+gL  + ++ FL+  +f   +++ y   lL++ + ++ +
  gi|7415941   684 EMIKKILASSYEGLTYHLKSCFLYMSIFPEDSDIRYRR-LLrrwtaegys 732  

                   .adsnnLDVrqG...LkvLadKSLIhisplgned.kvdgtieMHnLLqqL
                   +a  n  + ++ +++++ L +KS I+ s ++ + +k  g++   nL    
  gi|7415941   733 rATRNRSNEKVAeeqFTALLNKSMIQQS-KTIASgK-TGFCQVYNLMH-- 778  

                   GReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDt
                     e I+  +s             + e    VL+d++ ++           
  gi|7415941   779 --E-IIISKS-------------EEENLVLVLDDHITSR----------- 801  

                   seieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   s+ +    +           + L + k++ +++++   
  gi|7415941   802 SKDK----V-----------RHLVVSKSW-SREKN    820  

gi|8925783|gb|AAF81616.1|: domain 1 of 1, from 1 to 159: score -179.0, E = 0.002
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                                TIA+A
  gi|8925783     1    ------------------------------------------TIAKA 5    

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++++      ++F+ + F   +r      e+ +         e +    
  gi|8925783     6 IYNKIG-----RNFEARSFLADIR------EVWG--------QEAG---H 33   

                   LhLQeqfLSkILnqkDikIhdHLG....vieERLkdqKVLIiLDDVDdle
                    +LQeq+L  I + ++ kIh +  +++  ++ERL++++ L+iLDDV++l+
  gi|8925783    34 VCLQEQLLFDIHKENNTKIH-NIEsgkiILRERLRHKRILLILDDVNKLQ 82   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   QL +L +  +WFG+GSRII+TT D +LL+  +++  +   +    +e  +
  gi|8925783    83 QLNVLCGNREWFGSGSRIIITTRDVHLLRGKRVDQ-VFSMKGMDVDESIE 131  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    F  +AF+Q sP+++F eL +r V+                         
  gi|8925783   132 LFSWHAFKQASPKEDFIEL-SRNVV------------------------- 155  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                                                                     
  gi|8925783     - -------------------------------------------------- -    

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                                                                     
  gi|8925783     - -------------------------------------------------- -    

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                        A                                            
  gi|8925783   156 -----A-------------------------------------------- 156  

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                              y            
  gi|8925783   157 ---------------------------YSG-------    159  

gi|5734781|gb|AAD50046.1|AC007980_11: domain 1 of 1, from 163 to 559: score -179.5, E = 0.0021
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                          +lVG+E  lek+   L     +  r   I+G  G GKTT A+ 
  gi|5734781   163    ----NLVGLEQSLEKLVNDLVSGG-EKLRVTSICGMGGLGKTTLAKQ 204  

                   LfsqLSerhFq.ssFqlsaFmenlrgsysk...eeigSgetrpaglDeYs
                    f  +      ++ F   a ++ +  ++ ++  ++i+ + +++   De +
  gi|5734781   205 IFHHHK----VrRHFDRFAWVYVSQDCRRRhvwQDIFLNLSYK---DENQ 247  

                   yGmKLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDV...D
                       L+L+ +       q + + h  +      Lk  K LI+LDD+ ++D
  gi|5734781   248 --RILSLRDE-------QLGEELH-RF------LKRNKCLIVLDDIwgkD 281  

                   dleQLd.ALAketqWFGpGSRIIVTTeDkqL.Lka..HgInhtIYeVgfP
                     + L+++   et     GS II TT +k+  L a++ g+ h   e  + 
  gi|5734781   282 AWDCLKhVFPHET-----GSEIILTTRNKEVaLYAdpRGVLH---EPQLL 323  

                   SkeeALqI.....FCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVl
                   + ee  +  ++ ++      +       ee+  ++++ ++G LPL+  Vl
  gi|5734781   324 TCEESWELlekisLSGRENIEPMLVKKMEEI-GKQIVVRCGGLPLAITVL 372  

                   GSsLRGksk.eeWedmLpRLrtsf...gnsLDgk....IekvLrvsYDgL
                   G  L  ks  +eW ++   +++ + ++g+s +g ++  + +vL  sY+ L
  gi|5734781   373 GGLLATKSTwNEWQRVCENIKS-YvsnGGSSNGSknmlVADVLCLSYEYL 421  

                   hekDqaLFLhIACfFN.gek..vdyVkalLadsnnLDVrqG.........
                     + +  FL+ A    ++e +  ++V   +a+     V++ + +++ ++ 
  gi|5734781   422 PPHVKQCFLYFAHYPEdYEVhvGTLVSYCIAEGMVMPVKHTeagttvedv 471  

                   ....LkvLadKSLIhisplgned.kvdgtieMHnLLqqLGReAIVrkQsi
                   +++ L+ L+ +S + + + +   ++   t++MH+L +++  +    kQ+ 
  gi|5734781   472 gqdyLEELVKRSMVMVGRRDIVTsE-VMTCRMHDLMREVCLQ--KAKQES 518  

                   dhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtseieeelnIse
                              v   + +d   d+          Isl t+     +++  
  gi|5734781   519 ----------FVQVIDSRD--QDEAEAF------ISLSTNTSR-RISV-- 547  

                   kAFegMrNLqFLriykksfrddgk<-*
                                 +   + ++ k   
  gi|5734781   548 ------------QLHGGAEEHHIK    559  

gi|7488664|pir||T08821: domain 1 of 1, from 1 to 170: score -179.7, E = 0.0021
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                +V           GKTT A A
  gi|7488664     1    -------------------------GGV-----------GKTTLAVA 11   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++ +        F+ s+F en+r           et+++          
  gi|7488664    12 VYNSIA-----GHFEASCFLENVR-----------ETSNKKGLQ------ 39   

                   LhLQeqfLSkILnqkDikIhdHLG....vieERLkdqKVLIiLDDVDdle
                    hLQ  +LSk  + k ik   +  ++ + i+  Lk++KVL+iLDDVD  +
  gi|7488664    40 -HLQSILLSKTVGEKKIKLT-NWRegipIIKHKLKQKKVLLILDDVDEHK 87   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                    L A+ +   WFG+GSR+I+TT + +LL  H+++ t Y+V    +++ALq
  gi|7488664    88 HLQAIIGSPDWFGCGSRVIITTRNEHLLALHNVKIT-YKVRELNEKHALQ 136  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    + + AF          eL                               
  gi|7488664   137 LLTQKAF----------EL------------------------------- 145  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                          ++      D                              + + 
  gi|7488664   146 -------EK----EVDSS----------------------------YND- 155  

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                                          ++ LI                      
  gi|7488664   156 ---------------------ILNRALIY--------------------- 163  

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                        A                                 +g         
  gi|7488664   164 -----A---------------------------------SG--------- 166  

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                           L               
  gi|7488664   167 ------------------------LPLA---------    170  

gi|11990500|gb|AAG42168.1|: domain 1 of 1, from 164 to 528: score -179.8, E = 0.0022
                   *->rDFddlVGiEaHlekmksLLcLdskdeV.....rMVGIwGPaGIGKT
                      +  ++l+G +     +  +L  +  deV +++ +MV I G  G GKT
  gi|1199050   164    KKAEELIGTKEKSLDIVKMLT-EG-DEVfkkhlKMVSIVGFGGLGKT 208  

                   TIARALfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeY
                   T A + + +L       +F   aF++ ++                   + 
  gi|1199050   209 TLANVVYEKLR-----GDFDCAAFVS-VS------------------LNP 234  

                   syGmKLhLQeqfLSkIL..nqkDik..........IhdHLGvieERLkdq
                   +  mK  L + +L ++ ++  k+i++++  ++++ I++    i++ L+d+
  gi|1199050   235 D--MK-KLFKCLLHQLDkgEYKNIMdesawsetqlISE----IRDFLRDK 277  

                   KVLIiLDDV......DdleQLdALAketqWFGpGSRIIVTTeDkqLLkaH
                   + +I +DD+ +++  +++    AL    +   +GSR+I TT  + L  a 
  gi|1199050   278 RYFILIDDIwdksvwNNIR--CALIE-NE---CGSRVIATT--RILDVAK 319  

                   gInhtIYeVgfPSkeeALqIFCrsAF..gQnsPpdGFeeLeAreVtkLaG
                   ++   +Y+ +  S+ +  q F +  F+ g + Pp    e  ++++   +G
  gi|1199050   320 EVGG-VYQLKPLSTSDSGQLFYQRIFgiGDKRPPIQLAEV-SEKILGKCG 367  

                   nLPLGLrVlGSsLRGkskee.....Wed....mLpRLrtsfgnsLDgkIe
                     PL+   l S L Gk+++e++ + W +  ++m   L++    +L  +  
  gi|1199050   368 GVPLAIITLASMLAGKKEHEntytyWYKvyqsMGSGLEN--NPGL-MDMR 414  

                   kvLrvsYDgLhekDqaLFLhIACf...FNgekvdyVkalLadsnnLDVrq
                    +L vsY +L  + +   L+    +++ N e+ +++ +++++        
  gi|1199050   415 RILHVSYYDLPPNLKTCLLYLSLYpedYNIETKELIWKWIGEG------- 457  

                   GLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGReAIVrkQsidhde
                             Ih + +             + L ++G +          + 
  gi|1199050   458 ---------FIHEEQG-------------KSLYEVGED----------Y- 474  

                   PgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtseieeelnIsekAFe
                               I +  +            +  ++ +    + +++ +++
  gi|1199050   475 ------------IAELINKSLVQP------MYINIANKASSVRVHDMVLD 506  

                   gMrNLq....FLriykksfrddgk<-*
                    ++ L ++++FL       + +     
  gi|1199050   507 LITSLSneenFLATLGG--QQTRS    528  

gi|12330442|gb|AAG52758.1|AF263329_1: domain 1 of 1, from 1 to 105: score -179.8, E = 0.0022
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                           +++                       
  gi|1233044     1    ---------------------MEN----------------------- 3    

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                        S                 +               +++D+Y+  mK
  gi|1233044     4 ----YS-----------------K---------------SNPDDYN--MK 15   

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   LhLQe+fLSkIL++k i+++ HLGv++  Lkd KVLIi+DD+Dd+++Ld+
  gi|1233044    16 LHLQENFLSKILDKKIIEVD-HLGVVKGKLKDLKVLIIIDDLDDQVVLDT 64   

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   L++  +WFGp SR+IV+T+Dkq+L+ HgI++ IY Vg             
  gi|1233044    65 LVGGDEWFGPRSRVIVITKDKQILRGHGIKC-IYXVG------------- 100  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                                              P                      
  gi|1233044   101 ---------------M-----------P---------------------- 102  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                                                                     
  gi|1233044     - -------------------------------------------------- -    

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                        s                                            
  gi|1233044   103 -----S-------------------------------------------- 103  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtse
                   e                                   +             
  gi|1233044   104 E-----------------------------------K------------- 105  

                   ieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                       
  gi|1233044     - ---------------------------------    -    

gi|4521190|dbj|BAA76281.1|: domain 1 of 1, from 355 to 752: score -180.1, E = 0.0022
                   *->rDFddlVGiEaHlekmk.sLLcLdskdeVrMVGIwGPaGIGKTTIAR
                           l+G E  + ++ +++L  ds ++V  + +wG  G GKTT   
  gi|4521190   355    ---SQLIGREKEISEIThLILNNDS-QQVQVISVWGMGGLGKTTLVS 397  

                   ALfs..qLSerhFqssFqlsaFmenlrgsysk............eeigSg
                     + +++LS     ++F   +F++ ++    ++    +  ++  e+ + g
  gi|4521190   398 GVYQspRLS-----DKFDKYVFVT-IM----RpfilvellrslaEQLHKG 437  

                   etrpaglDeYsyGmKLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKV
                   ++ + +l e   ++K +L          ++D +     G ++  L  +  
  gi|4521190   438 SSKKEELLENRVSSKKSLA--------SMEDTELT---GQLKRLLEKKSC 476  

                   LIiLDDV......Ddle.QLdALAketqWFGpGSRIIVTTeDkqLL....
                   LI+LDD +++++ D++++ L  L  +t      SRIIVTT    + ++ +
  gi|4521190   477 LIVLDDFsdtsewDQIKpTLFPLLEKT------SRIIVTTRKENIAnhcs 520  

                   .kaHgInhtIYeVgfPSkeeALqIFCrsAFgQnsPpdGFe..eL..eAre
                   +k  ++ +   +V      +AL  +    F + +  d+ +++eL +eA++
  gi|4521190   521 gKNGNVHNL--KVL--KHNDALCLLSEKVFEEATYLDDQNnpELvkEAKQ 566  

                   VtkLaGnLPLGLrVlGSsLRG..kskeeW....edmLpRLrtsfgnsLDg
                   + k ++ LPL+  V G  L  ++k+ eeW++ +e++  +L+      L g
  gi|4521190   567 ILKKCDGLPLAIVVIGGFLANrpKTPEEWrklnENINAELEM--NPEL-G 613  

                   kIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyV............ka
                    I  vL  sYDgL  + ++ FL+  +f   +++++ +  ++   ++ ++a
  gi|4521190   614 MIRTVLEKSYDGLPYHLKSCFLYLSIFPEDQIISRRrlvhrwaaegysTA 663  

                   lLadsnnLDVrqG.LkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                     ++s    + +G +  L ++S I                     qq G 
  gi|4521190   664 AHGKS-AIEIANGyFMELKNRSMILPF------------------QQSGS 694  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtse
                        ++si            D+   +d   d   ++           s 
  gi|4521190   695 S----RKSI------------DSCKVHDLMRDIAISK-----------ST 717  

                   iee.elnIsekAFegMr.NLqFLriykksfrddgk<-*
                    e+ ++ ++e     +++  + L i  ++++d+ +   
  gi|4521190   718 EENlVFRVEEGCSAYIHgAIRHLAISSNWKGDKSE    752  

gi|6172381|dbj|BAA85975.1|: domain 1 of 1, from 401 to 798: score -180.1, E = 0.0022
                   *->rDFddlVGiEaHlekmk.sLLcLdskdeVrMVGIwGPaGIGKTTIAR
                           l+G E  + ++ +++L  ds ++V  + +wG  G GKTT   
  gi|6172381   401    ---SQLIGREKEISEIThLILNNDS-QQVQVISVWGMGGLGKTTLVS 443  

                   ALfs..qLSerhFqssFqlsaFmenlrgsysk............eeigSg
                     + +++LS     ++F   +F++ ++    ++    +  ++  e+ + g
  gi|6172381   444 GVYQspRLS-----DKFDKYVFVT-IM----RpfilvellrslaEQLHKG 483  

                   etrpaglDeYsyGmKLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKV
                   ++ + +l e   ++K +L          ++D +     G ++  L  +  
  gi|6172381   484 SSKKEELLENRVSSKKSLA--------SMEDTELT---GQLKRLLEKKSC 522  

                   LIiLDDV......Ddle.QLdALAketqWFGpGSRIIVTTeDkqLL....
                   LI+LDD +++++ D++++ L  L  +t      SRIIVTT    + ++ +
  gi|6172381   523 LIVLDDFsdtsewDQIKpTLFPLLEKT------SRIIVTTRKENIAnhcs 566  

                   .kaHgInhtIYeVgfPSkeeALqIFCrsAFgQnsPpdGFe..eL..eAre
                   +k  ++ +   +V      +AL  +    F + +  d+ +++eL +eA++
  gi|6172381   567 gKNGNVHNL--KVL--KHNDALCLLSEKVFEEATYLDDQNnpELvkEAKQ 612  

                   VtkLaGnLPLGLrVlGSsLRG..kskeeW....edmLpRLrtsfgnsLDg
                   + k ++ LPL+  V G  L  ++k+ eeW++ +e++  +L+      L g
  gi|6172381   613 ILKKCDGLPLAIVVIGGFLANrpKTPEEWrklnENINAELEM--NPEL-G 659  

                   kIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyV............ka
                    I  vL  sYDgL  + ++ FL+  +f   +++++ +  ++   ++ ++a
  gi|6172381   660 MIRTVLEKSYDGLPYHLKSCFLYLSIFPEDQIISRRrlvhrwaaegysTA 709  

                   lLadsnnLDVrqG.LkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                     ++s    + +G +  L ++S I                     qq G 
  gi|6172381   710 AHGKS-AIEIANGyFMELKNRSMILPF------------------QQSGS 740  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtse
                        ++si            D+   +d   d   ++           s 
  gi|6172381   741 S----RKSI------------DSCKVHDLMRDIAISK-----------ST 763  

                   iee.elnIsekAFegMr.NLqFLriykksfrddgk<-*
                    e+ ++ ++e     +++  + L i  ++++d+ +   
  gi|6172381   764 EENlVFRVEEGCSAYIHgAIRHLAISSNWKGDKSE    798  

gi|7489348|pir||T08421: domain 1 of 1, from 158 to 544: score -180.1, E = 0.0023
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                   +  + L  Ld      M+  wG  G+GKTT    
  gi|7489348   158    -------------TFTEALNALDPNHKSHMIALWGMGGVGKTTMMHR 191  

                   LfsqLSerhFqssFqlsaFmenlrgsysk.eeigSgetrpaglDeYsyGm
                   L          ++  ++ ++e + g   ++ +i S       + +Y   +
  gi|7489348   192 LKKVVK-----EKKMFNFIIEAVVGEKTDpIAIQS------AVADY---L 227  

                   KLhLQeqfLSkILnqkDikIhdHLGvieERLkd....qKVLIiLDDV...
                      L e+        k  + +  L   + +  d+++++K L+iLDDV + 
  gi|7489348   228 GIELNEK-------TKPARTE-KL---RKWFVDnsggKKILVILDDVwqf 266  

                   ...DdleQLdALAketqWFGpGSRIIVTTeDkqLLkaHg..InhtIYeVg
                    + +d+  L  L ++    G    +  T  Dk      g ++n t   V+
  gi|7489348   267 vdlNDIG-LSPLPNQ----GVDFKVLLTSRDKDVCTEMGaeVNST-FNVK 310  

                   fPSkeeALqIFCrsAFgQns..PpdGFeeLeAreVtkLaGnLPLGLrVlG
                      + eA   F++  F + s++      ++  + +++ +G LP + + + 
  gi|7489348   311 MLIETEAQSLFHQ--FIEISddVDPELHNI-GVNIVRKCGGLPIAIKTMA 357  

                   SsLRGkskeeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhek.DqaLF
                     LRGksk+ W+++L RL+      +   +  v + sYD L +++ ++ F
  gi|7489348   358 CTLRGKSKDAWKNALLRLEH---YDIENIVNGVFKMSYDNLQDEeTKSTF 404  

                   LhIACfFNgekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgne..
                   L+  C    e+ d +++ L          GLk        ++ + g++++
  gi|7489348   405 LL--CGMYPEDFDILTEELVRY-----GWGLKLFK-----KVYTIGEArt 442  

                   ..................dkvdgtieMHnLLqqLGReAIVrk...Qsidh
                   + ++  ++  +++   + d+  ++i+MH+L + +  +    k ++ si  
  gi|7489348   443 rlntcierlihtnllmevDD-VRCIKMHDLVRAFVLD-MYSKvehASI-- 488  

                   dePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtseiee.elnIsek
                            v+     +  +dn  +++++    sl   ++++   +    
  gi|7489348   489 ---------VNHSNTLEWHADNMHDSCKRL---SLTCKGMSKfPTDL--- 523  

                   AFegMrNLqFLri.ykksfrddgk<-*
                      + +NL  L+  +++++ + +k   
  gi|7489348   524 ---KFPNLSILKLmHEDISLRFPK    544  

gi|14348622|gb|AAK61318.1|AF306502_1: domain 1 of 1, from 183 to 601: score -180.3, E = 0.0023
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      rD d  + i     +++     +s +   +  I G  G GKTT A  
  gi|1434862   183    RDADKDIIINWLTSEID-----NS-NHPSIFSIVGMGGLGKTTLAQH 223  

                   Lfs..qLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyG
                    ++++++       +F  +a +  ++                   ++   
  gi|1434862   224 VYNdpKIED----VKFDIKAWVC-VS-------------------DHF-- 247  

                   mKLhLQeqfLSkILnqkD....ikIhdHLGvieERLkdqKVLIiLDDVDd
                     L   +  L  I+++ D++++++   H   ++E L  +K L++LDDV +
  gi|1434862   248 HVLTVTRTILEAITDKTDdsgnLEMV-HK-KLKEKLSGKKFLLVLDDVWN 295  

                   leQLdALAketqW........FG.pGSRIIVTTeDkqLLkaHg..InhtI
                             ++W+  +++ ++G pGSRI VTT   +   + ++++ +  
  gi|1434862   296 ER-------PAEWeavqtplsYGaPGSRILVTTRSEKVASSMRseVHL-L 337  

                   YeVgfPSkeeALqIFCrsAFgQnsPp..dGFeeLeAreVtkLaGnLPLGL
                    + g   ++e  + F  +A +      +d F++   r++++ +  LPL+L
  gi|1434862   338 KQLG---EDECRKVFENHALKDGDIElnDEFMKV-GRRIVEKCKGLPLAL 383  

                   rVlGSsLR.GkskeeWedmLp....RLrtsfgnsLDgkIekvLrvsYDgL
                   +  G  L +  s  +W+++L ++  +L +      + +I   L  sY  L
  gi|1434862   384 KTIGCLLStNSSISDWKNILEseiwELPK-----EHSEIIPALFLSYHHL 428  

                   hekDqaLFLhIACfFNgekvdyVkalLadsnnLDVrqGLkvLadKSLIhi
                    ++ +  F + A +F +   + Vk+ L           +   a+  L + 
  gi|1434862   429 PSHLKRCFAYCA-LFPKDY-EFVKEELI----------FLWMAQNFLLST 466  

                   splgne....................d.kvdgtieMHnLLqqLGReAIVr
                      + +++++ +++  ++  ++   +++ v g+ +MH+LL  L++  +  
  gi|1434862   467 Q--HIRhpkqigeeyfndllsrcffnKsSVVGRFVMHDLLNDLAKY-VYA 513  

                   k..........QsidhdePgKRqFLvDaeeI.....cdVLtdnTGtgtrs
                       + + +++Q i   +   R+F +++++ ++ ++ + Ltd++  +  s
  gi|1434862   514 DfcfrlkfdneQYI---QKTTRHFSFEFRDVksfdgFESLTDAKKLR--S 558  

                   VlGIslDtseiee.elnIsekAFegMrNLqFLriykksfrddgk<-*
                   +  Is   +   + +++I  + F ++   + L++  +++ ++ +   
  gi|1434862   559 FFSISQYGRSPWDfKISI-HDLFSKIKFIRVLSFRGCLDLREVP    601  

gi|8118168|gb|AAF72922.1|: domain 1 of 1, from 1 to 153: score -180.5, E = 0.0024
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                                   RA
  gi|8118168     1    -----------------------LT--------------------RA 4    

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++++      ++F+  +F  n+r           e++++   eY     
  gi|8118168     5 IYNLIA-----DQFEGLCFLHNVR-----------ENSIKYGLEY----- 33   

                   LhLQeqfLSkILnqkDikIhdHLG....vieERLkdqKVLIiLDDVDdle
                     LQeq+L k ++ k ik   H  ++ + i++ L+ +KVL+iLDD+D+l+
  gi|8118168    34 --LQEQLLFKSIGLK-IKLG-HVSegipIIKQGLHTKKVLLILDDIDKLK 79   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   QL++L+++  W G+GSR+I+TT DkqLL +HgI   IYe           
  gi|8118168    80 QLEVLVGDPGWLGHGSRVIITTRDKQLLSSHGIQK-IYE----------- 117  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                                                              G +    
  gi|8118168   118 -------------------A----------------------YGLN---K 123  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFN.gek
                   e +L  Lrt                         +a        F ++++
  gi|8118168   124 EQALELLRT-------------------------KA--------FKsKKN 140  

                   vdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLL
                            ds                                       
  gi|8118168   141 ---------DS--------------------------------------- 142  

                   qqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIs
                                                            +        
  gi|8118168   143 -----------------------------------------S-------- 143  

                   lDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                               y+ +  ++ k   
  gi|8118168   144 ----------------------------YDYILNRAVK    153  

gi|9758146|dbj|BAB08703.1|: domain 1 of 1, from 158 to 583: score -180.8, E = 0.0024
                   *->rDFddlVGiEaHlekmk.sLLcLdskdeVrMVGIwGPaGIGKTTIAR
                          dlVG E   e++ + +   d+  +V  V I+G  GIGKTT AR
  gi|9758146   158    SSESDLVGVEQSVEELVgPMVEIDN-IQV--VSISGMGGIGKTTLAR 201  

                   ..ALfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsy
                   + + +++       + F   a +  +                       +
  gi|9758146   202 qiFHHDLVR-----RHFDGFAWVCVSQQ---------------------F 225  

                   GmKLhLQeqfL......SkILnqkDikIhdHLGvieERLkdqKVLIiLDD
                     K  +Q+ + + ++++ +IL ++   I    G + + L   + L++LDD
  gi|9758146   226 TQKHVWQRILQelrphdGEILQMDEYTIQ---GKLFQLLETGRYLVVLDD 272  

                   V......DdleQLdALAketqWFGpGSRIIVTTeDkqLLkaHg..InhtI
                   V ++++ D ++  ++   +  W             k LL + ++++ +  
  gi|9758146   273 VwkeedwDRIK--EVFPRKRGW-------------KMLLTSRNegVGL-- 305  

                   YeVgfPSk..........eeALqIFCrsAFgQnsPp.dGFeeLeAreVtk
                    + + P+  + + +  +++e  + F r   ++n    +  e +  +e ++
  gi|9758146   306 -HAD-PTClsfrarilnpKESWKLFERIVPRRNETEyEEMEAI-GKEMVT 352  

                   LaGnLPLGLrVlGSsLR.GkskeeWedmLpRLrtsf..gnsLDgk....I
                    +G LPL+ +VlG  L +  +  eW+++   +   + +  +LD+++ +++
  gi|9758146   353 YCGGLPLAVKVLGGLLAnKHTASEWKRVSENIGAQIvgKSCLDDNslnsV 402  

                   ekvLrvsYDgLhekDqaLFLhIACfFN.gekvdyVkal............
                     +L  sY++L    +  FL+ A f  ++++ ++ + ++    ++  ++ 
  gi|9758146   403 YRILSLSYEDLPTDLKHCFLYLAHFPEdYKI-KTRTLYsywaaegiydgl 451  

                   .LadsnnLDVrqGLkvLadKSLIhisplgned.kvdgtieMHnLLqqLGR
                   ++ ds+    +  L+ L+ + L+ i +++n   +  + + MH++ +++  
  gi|9758146   452 tILDSG----EDYLEELVRRNLV-IAEKSNLSwR-LKLCQMHDMMREVC- 494  

                   eAIVrk....................QsidhdePgKRqFLvDaeeIcdVL
                     I  ++ ++  +  + ++++++   Qs      + R+  v +     +L
  gi|9758146   495 --ISKAkvenflqiikvptststiiaQSP----SRSRRLTVHSGKAFHIL 538  

                   tdnTGtgtrsVlGIslDtseieeelnIsekAFegMrNLqFLriykksfrd
                    +++  ++  VlG   D++ i+     s + F+ ++ L+ L       ++
  gi|9758146   539 GHKKKVRSLLVLGLKEDLW-IQ-----SASRFQSLPLLRVLDLSSV--KF 580  

                   dgk<-*
                   +g    
  gi|9758146   581 EGG    583  

gi|11612210|gb|AAG37354.1|: domain 1 of 1, from 162 to 526: score -181.3, E = 0.0026
                   *->rDFddlVGi.EaHlekmksLLcLdskdeV.....rMVGIwGPaGIGK
                          +lVGi +   + +  LL ++  d++++++ + V I G  G GK
  gi|1161221   162    AEATELVGIyGKRDQDLMRLLSMEG-DDAsnkrlKKVSIVGFGGLGK 207  

                   TTIARALfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDe
                   TT ARA + ++       +F  +aF+                   +g + 
  gi|1161221   208 TTLARAVYEKIK-----GDFDCRAFVP------------------VGQNP 234  

                   YsyGmKLhLQeqfLSkILnqkDikIhdHLGv......ieERLkdqKVLIi
                   +   mK  L+  +    L+  +      L +++  ++++E L +++ L+i
  gi|1161221   235 H---MKKVLRDILID--LGNPHSDLA-MLDAnqlikkLREFLENKRYLVI 278  

                   LDDVDdleQLd....ALAketqWFGpGSRIIVTTe....DkqLLkaHgIn
                   +DD+ d ++ ++ + A  +  +    GSR I TT   +       +Hg +
  gi|1161221   279 IDDIWDEKLWEginfAFSNRNN---LGSRLITTTRivsvSNSCCSSHG-D 324  

                   htIYeVgfPSkeeALqIFCrsAFgQnsPpdG.....FeeLeAreVtkLaG
                     +Y+ +  S ++    F    +++ +P + +  ++Fe+  +r + k +G
  gi|1161221   325 S-VYQMEPLSVDDSRILF----WKRIFPDENgclneFEQV-SRDILKKCG 368  

                   nLPLGLrVlGSsLRG....kskeeWedmLpRLrtsf..gnsLDgkIekvL
                     PL+     S+L G+++ k k eW  +L  L +++++ nsL ++   +L
  gi|1161221   369 GVPLAIITIASALAGdqkmKPKCEWDILLQSLGSGLteDNSL-EEMRRIL 417  

                   rvsYDgLhekDqaLFLhIACfFNgekvdyVkalLadsnnLDVrqGLkvLa
                    +sY  L ++ +   L+  +    +k  +  +l+ +             +
  gi|1161221   418 SFSYSNLPSHLKTCLLYLCIYPEDSK-IHRDELIWKW------------V 454  

                   dKSLIhisplgnedkvdgtieMHnLLqqLGReAIVrkQsidhdePgKRqF
                       +h ++ g            n L  LG      +Q i          
  gi|1161221   455 AEGFVHHENQG------------NSLYLLGLN--YFNQLI---------- 480  

                   LvDaeeIcdVLtdnTGtgtrsVlGIslDtseieeelnI...sekAFegMr
                               + +  +          +++ ++e+++ + ++ +++ ++
  gi|1161221   481 ------------NRSMIQ---------PIYGFNDEVYVcrvHDMVLDLIC 509  

                   NL....qFLriykksfrddgk<-*
                   NL+++ +F +  +     +g+   
  gi|1161221   510 NLsreaKFVNLLDG----SGN    526  

gi|14348619|gb|AAK61317.1|AF306501_1: domain 1 of 1, from 181 to 599: score -181.6, E = 0.0027
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      rD d  + i     + +     +  ++  +  I G  G GKTT A  
  gi|1434861   181    RDVDKDIIINWLTSETN-----NP-NQPSILSIVGMGGLGKTTLAQH 221  

                   LfsqLSerhFq.ssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGm
                    ++       ++ +F  +a +  ++                   ++    
  gi|1434861   222 VYNDRK---IDgAKFDIKAWVC-VS-------------------DHF--H 246  

                   KLhLQeqfLSkILnqkD....ikIhdHLGvieERLkdqKVLIiLDDV...
                    L   +  L  I+nqkD++++++   H   ++E L  +K +++LDDV ++
  gi|1434861   247 VLTVTRTILEAITNQKDdsgnLEMV-HK-KLKEKLSGRKFFLVLDDVwne 294  

                   ..DdleQLdALAketqWFG.pGSRIIVTTeDkqLL.....kaHgInhtIY
                   +++  e+  +       +G pGS I VTT   +  ++ ++k H+ +    
  gi|1434861   295 krEEWEVVRTPLS----YGaPGSKILVTTREEKVAsnmssKVHRLKQL-- 338  

                   eVgfPSkeeALqIFCrsAF..gQnsPpdGFeeLeAreVtkLaGnLPLGLr
                         +ee    F  +A ++g     d  +e+  r+++ ++  LPL+L+
  gi|1434861   339 -----REEECWNVFENHALkdGDYELNDELKEI-GRRIVDRCKGLPLALK 382  

                   VlGSsLR.GkskeeWedmLp....RLrtsfgnsLDgkIekvLrvsYDgLh
                     G  LR+  s  +W+++L ++  +L +      + +I   L  sY  L 
  gi|1434861   383 TIGCLLRtKSSISDWKNILEseiwELPK-----ENNEIIPALFMSYRYLP 427  

                   ekDqaLFLhIACf...FNgekvdyVkalLadsnnL....DVrqG......
                   ++ +  F + A f+++   ek +++  + a + +L+ ++ Vr++++ +++
  gi|1434861   428 SHLKKCFAYCALFpkdYEFEKKELILMWMAQN-FLqcpqQVRHReevgee 476  

                   .LkvLadKSLIhisplgnedkvdgtieMHnLLqqLGReAIVrk.......
                    ++ L  +S  + s         ++  MH+LL  L++   V+++   + +
  gi|1434861   477 yFNDLLSRSFFQQSGV------RRRFIMHDLLNDLAKY--VCAdfcfrlk 518  

                   ....QsidhdePgKRqFLvDaeeIcdV.....LtdnTGtgtrsVlGIslD
                    +++Q+i       R+F +++++I   ++ ++L+d++  +  s+l  s  
  gi|1434861   519 fdkgQCI---PKTTRHFSFEFHDIKSFdgfgsLSDAKRLR--SFLQFSQA 563  

                   tseiee.elnIsekAFegMrNLqFLriykksfrddgk<-*
                   ++   + +++I  + F ++   + L++  +sf ++ +   
  gi|1434861   564 MTLQWNfKISI-HDLFSKIKFIRMLSFCGCSFLKEVP    599  

gi|5669778|gb|AAD46469.1|AF108008_1: domain 1 of 1, from 136 to 537: score -181.9, E = 0.0028
                   *->rDFddlVGiEaHlekmksLLcLdskdeV....rMVGIwGPaGIGKTT
                      rD +dlVGiE   e++   L     d+V++++r   +wG +G+GKTT
  gi|5669778   136    RD-EDLVGIEENKERLIRWLADGG-DGVeqssRVTLVWGMPGVGKTT 180  

                   IARALfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYs
                        ++         +F   a ++ +++sy             ++ +  
  gi|5669778   181 LVDHVYNTVK-----LDFDAAAWVT-VSESY-------------CIEDPL 211  

                   yGmKLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdle
                      K + Q      ++n +          i + L+ +K   +LDDV    
  gi|5669778   212 --KKISAQFGIAVDVTNNEMRGLA-KS--IHNYLQGKKYIMVLDDVWAER 256  

                   QLdALAketqWFGpGS....RIIVTTeDkqLLkaHgInhtIYeVgfPSke
                       L  e++   p S++++R+I+T   +  L   +  +   + + P + 
  gi|5669778   257 ----LWPEIRNVFPTSnstgRVIITSRKQTVLATRESSY-AIHLE-PLQA 300  

                   e.ALqIFCrsAF...gQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsL
                   +     FC  AF ++ ++  p + eeL A++++  +  LP +    G  L
  gi|5669778   301 HySWVLFCKGAFwttDEKKCPLDLEEL-AWKFIAKCQGLPIAIACIGRLL 349  

                   RG..kskeeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLh
                     ++ +  eWed+ + L + f +    +   +L+vs ++L    +  FLh
  gi|5669778   350 SCkpQNSVEWEDVYRCLDSQFAKDVIPDAHLILKVSLEDLPFDLKNCFLH 399  

                   IACfFN.gekvdyVkal.................LadsnnLDVrqGLkvL
                    A    ++e  ++ k++++  + +  ++++++++L++      +  L  L
  gi|5669778   400 CALSPEdYEL-KRRKTMrqwitagfitekdesktLEEV----AEGYLVEL 444  

                   adKSLIhisplgnedkv..dgtieMHnLLqqLGReAIVrkQsidhdePgK
                   +++SL ++    +++++++ +++ MH+  + L+      k+++     gK
  gi|5669778   445 VNRSLLRVV---QRNHTgrLKCCQMHDVIRLLALN--KAKEEF----FGK 485  

                   RqFLvDaeeIcdVLtdnTGtgtrsVlG...IslDtseieeelnIsekAFe
                        +          +TG    sV G ++Is    ++e +l+ s     
  gi|5669778   486 G---YNGS-------GCTGAF--SVEGarrISVQCGNLE-QLSRSCA--- 519  

                   gMrNLqFLriykksfrddgk<-*
                     r L+ L++++++   d     
  gi|5669778   520 --RHLRALHVFERYINVDLL    537  

gi|8118158|gb|AAF72917.1|: domain 1 of 1, from 2 to 156: score -181.9, E = 0.0028
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                               ++V                   
  gi|8118158     2    -----------------------A-QAV------------------- 5    

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++ +      ++F+ ++F  n+r                ++D ++    
  gi|8118158     6 -YNSIA-----KQFECKCFLHNVR---------------ENSDKHG---L 31   

                   LhLQeqfLSkILnqkDi..kIhdHLGvieERLkdqKVLIiLDDVDdleQL
                     LQeq+LSk ++ k   + +++    i+ RL+++KVL+iLDDV++l+QL
  gi|8118158    32 IYLQEQLLSKSIGFKERfgHVNEGIPIIRRRLCQKKVLLILDDVNKLKQL 81   

                   dALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIF
                    +L +e + FG+GSR+I+TT Dk+LL +HgI+  IYe             
  gi|8118158    82 QVLIGEPSSFGHGSRVIITTRDKHLLSSHGIKK-IYE------------- 117  

                   CrsAFgQnsPpdGFeeL.eAreVtkLaGnLPLGLrVlGSsLRGkskeeWe
                              +G   L+e                              e
  gi|8118158   118 ----------AHG---LnE------------------------------E 124  

                   dmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvd
                    +L  Lrt                         +a        F + k d
  gi|8118158   125 QALELLRT-------------------------KA--------FKCNKND 141  

                   yVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqq
                      +++ +                                          
  gi|8118158   142 SRYDYILNR----------------------------------------- 150  

                   LGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslD
                       AI                                 +          
  gi|8118158   151 ----AI---------------------------------K---------- 153  

                   tseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                             y +          
  gi|8118158   154 --------------------------YAS-------    156  

gi|13937092|gb|AAK50045.1|AF363800_1: domain 1 of 1, from 1 to 168: score -182.0, E = 0.0028
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                ++           GKTT A A
  gi|1393709     1    -------------------------GGM-----------GKTTLALA 11   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++++      ++F  s+F  n+r                +l  ++  +K
  gi|1393709    12 TYNLIA-----HDFDGSCFLQNVR---------------EELKKHG--LK 39   

                   LhLQeqfLSkILnqkDikIhdHLGvieER....LkdqKVLIiLDDVDdle
                    hL+   LS+IL+ k+i   +    +e R++++ + +KVL+iLDDVD+ +
  gi|1393709    40 -HLRDLILSEILGEKNINLAE--SNAEFRdttkARRKKVLLILDDVDNRK 86   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   +L A A+ + WFGpGSR+I+TT D qLLk H+++ t              
  gi|1393709    87 LLQAFAGRSDWFGPGSRVIITTRDEQLLKTHEVERT-------------- 122  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                                +  eeL                               
  gi|1393709   123 -------------EEVEEL------------------------------- 128  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                           +               +                  +FN+   
  gi|1393709   129 --------N-------------MMI------------------LFNCLL- 138  

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                        +L +               K  I+                     
  gi|1393709   139 ----GMLSKG--------------KIMIQ--------------------- 149  

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                         + r+ s+                   V t+++G           
  gi|1393709   150 ------VTRTSSK------------------HVATYASG----------- 164  

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                           L +             
  gi|1393709   165 ------------------------LPFA---------    168  

gi|2852690|gb|AAC02205.1|: domain 1 of 1, from 1 to 157: score -182.3, E = 0.0029
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                           L s   V                   
  gi|2852690     1    ---------------------LASS--V------------------- 5    

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++ +S     ++F   +F+en+r+          e++++gl        
  gi|2852690     6 -YDEIS-----RKFDGCCFVENIRE----------ESSKNGLEK------ 33   

                   LhLQeqfLSkILnqkDikIhdHLGvieE.......RLkdqKVLIiLDDVD
                     LQe+ L  IL+qk  ++    G +eE+++   +RL+++KVLI+LDDVD
  gi|2852690    34 --LQEKILYGILKQK--QVQ--AGRVEEgkrmimsRLCHRKVLIVLDDVD 77   

                   dleQLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkee
                    +eQL+ALA+   WFG GSRII+TT D + L aH ++  +   ++  ++e
  gi|2852690    78 CIEQLKALAGSHDWFGEGSRIIITTRDEHVLTAHSVDV-VHNISLLNNDE 126  

                   ALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGksk
                   A++ FC +A     P ++ +eL           LP               
  gi|2852690   127 AMELFCKHAPQGHNPIED-YEL-----------LP--------------- 149  

                   eeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNg
                              +                                      
  gi|2852690   150 -----------K-------------------------------------- 150  

                   ekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHn
                      d V                                            
  gi|2852690   151 ---DVVA--------------------------Y---------------- 155  

                   LLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlG
                           A                                  g      
  gi|2852690   156 --------A----------------------------------G------ 157  

                   IslDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                              
  gi|2852690     - ----------------------------------------    -    

gi|13310471|gb|AAK18304.1|AF338971_1: domain 1 of 1, from 1 to 127: score -183.0, E = 0.0032
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                           +++ +eV                   
  gi|1331047     1    ---------------------MENVKEV------------------- 7    

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                     ++               +e                             
  gi|1331047     8 -CNRYG-------------VE----------------------------- 14   

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                    +LQ +fL  +++  D   +     i+ER + ++VLI+LDDVD +eQLd 
  gi|1331047    15 -RLQGEFLCRMFRERDSVSC--SSMIKERFRRKRVLIVLDDVDRSEQLDG 61   

                   LAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFCr
                   L+ket WFGpGSRIIVTT D++LL +HgI++ IY+V+   ++eAL  FC 
  gi|1331047    62 LVKETGWFGPGSRIIVTTRDRHLLVSHGIEL-IYKVKCLPEKEALHLFCN 110  

                   sAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmL
                   +AF+  +    F  L                                   
  gi|1331047   111 YAFRNETIAPEFRVL----------------------------------- 125  

                   pRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVk
                                                                     
  gi|1331047     - -------------------------------------------------- -    

                   alLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGR
                                                                     
  gi|1331047     - -------------------------------------------------- -    

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtse
                    A                                                
  gi|1331047   126 -A------------------------------------------------ 126  

                   ieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                       
  gi|1331047   127 --------------------------------V    127  

gi|9965109|gb|AAG09954.1|AF175399_1: domain 1 of 1, from 189 to 344: score -183.4, E = 0.0033
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                            VG     ++   LL+  s+d V ++GI+G  G GKTT A  
  gi|9965109   189    ------VGQASQVTEVMKLLDVGSDDVVHIIGIYGMRGLGKTTLALD 229  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++ +      + F  s+F  n+r                ++  ++  +K
  gi|9965109   230 VYNSIA-----RHFDESCFLQNVR---------------EESKKHG--LK 257  

                   LhLQeqfLSkILnqkDikIh...dHLGvieERLkdqKVLIiLDDVDdleQ
                    hLQ    Sk+L+ kDi   + ++    i+ RL+ +KVL+iLDDV++ eQ
  gi|9965109   258 -HLQSIIISKLLGEKDINLAsyrEGASMIQSRLRRKKVLLILDDVNKREQ 306  

                   LdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqI
                   L+A+++ + WFGpGSR+I+TT  k LLk H+++ t Y+            
  gi|9965109   307 LKAIVGRSDWFGPGSRVIITTRYKRLLKDHEVERT-YK------------ 343  

                   FCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWe
                                     +                               
  gi|9965109   344 ------------------V------------------------------- 344  

                   dmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvd
                                                                     
  gi|9965109     - -------------------------------------------------- -    

                   yVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqq
                                                                     
  gi|9965109     - -------------------------------------------------- -    

                   LGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslD
                                                                     
  gi|9965109     - -------------------------------------------------- -    

                   tseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                          
  gi|9965109     - ------------------------------------    -    

gi|12957124|emb|CAC29241.1|: domain 1 of 1, from 162 to 548: score -183.6, E = 0.0034
                   *->rDFddlVGi.EaHlekmksLLcLdskdeV.....rMVGIwGPaGIGK
                          +lVGi +   + +  LL ++  d++++++ + V I G  G GK
  gi|1295712   162    AEATELVGIyGKRDQDLMRLLSMEG-DDAsnkrlKKVSIVGFGGLGK 207  

                   TTIARALfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDe
                   TT ARA + ++       +F  +aF+  +                    +
  gi|1295712   208 TTLARAVYEKIK-----GDFDCRAFVP-VG------------------QN 233  

                   YsyGmKLhLQeqfLSkILnqkDikIhdHLGv......ieERLkdqKVLIi
                    +  mK  L+  +    L+  +      L +++  +++ E L +++ L+i
  gi|1295712   234 PD--MKKVLRDILID--LGNPHSDLA-MLDAnqlikkLHEFLENKRYLVI 278  

                   LDDVDdleQLd....ALAketqWFGpGSRIIVTTeDkqLLkaHgInht..
                   +DD+ d ++ ++ + A  +  +    GSR I TT  +    +      ++
  gi|1295712   279 IDDIWDEKLWEginfAFSNRNN---LGSRLITTT--RIVSVSNSCCSSdg 323  

                   ..IYeVgfPSkeeALqIFCrsAF.gQnsPpdGFeeLeAreVtkLaGnLPL
                   +++Y+ +  S ++  + F    F+ +n   + Fe+  +r + k +G  PL
  gi|1295712   324 dsVYQMEPLSVDDSRMLFSKRIFpDENGCINEFEQV-SRDILKKCGGVPL 372  

                   GLrVlGSsLRG....kskeeWedmLpRLrtsf..gnsLDgkIekvLrvsY
                   +     S+L G+++ k k eW  +L+ L +++++ nsL ++   +L +sY
  gi|1295712   373 AIITIASALAGdqkmKPKCEWDILLRSLGSGLteDNSL-EEMRRILSFSY 421  

                   ...................DgLhekDqaLFLhIACfFN.gekvdyVkalL
                   ++ +++ ++        ++D+  ++D+ +   +A  F ++e+  +   lL
  gi|1295712   422 snlpshlktcllylcvypeDSMISRDKLIWKWVAEGFVhHENQGNSLYLL 471  

                   adsnnLDVrqGLkvLadKSLIh.isplgnedkvdgtieMHnLLqqLGReA
                   + +        ++ L ++S I++i + + e      ++ H++   L    
  gi|1295712   472 GLN-------YFNQLINRSMIQpIYNYSGE---AYACRVHDMVLDLICN- 510  

                   IVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtseie
                      + ++           v+         d+TG++             ++
  gi|1295712   511 LSYEAKF-----------VNLL-------DGTGNS-------------MS 529  

                   eelnIsekAFegMrNLqFLriykksfrddgk<-*
                                +N + L+  k+ + d++    
  gi|1295712   530 -----------SQSNCRRLSLQKR-NEDHQV    548  

gi|7443912|pir||T12977: domain 1 of 1, from 156 to 516: score -183.7, E = 0.0034
                   *->rDFddl.VGiEaHlek.mksLLcLdskdeVrMVGIwGPaGIGKTTIA
                       D ++l VG+E+  +  +  LL  + kd   ++ I G  G GKT  A
  gi|7443912   156    VDQEELvVGLEDDVKIlLVKLLSDNEKDKSYIISIFGMGGLGKTALA 202  

                   RALfs..qLSerhFqssFqlsaFmenlrgsyskeeigSg..etrpaglDe
                   R L++++        ++F  +a  + ++  y+  +i  +   +  + + e
  gi|7443912   203 RKLYNsgDVK-----RRFDCRAWTY-VSQEYKTRDILIRiiRSLGIVSAE 246  

                   YsyGmKLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDV..
                        K    e+        + +++      +   L  +   ++ DDV +
  gi|7443912   247 EM--EKIKMFEE-------DEELEVY-----LYGLLEGKNYMVVVDDVwd 282  

                   .DdleQLd.ALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIY..eVgf
                   +D  e L++AL  + +    GS +I+TT  + +  a g++ t+Y ++  f
  gi|7443912   283 pDAWESLKrALPCDHR----GSKVIITTRIRAI--AEGVEGTVYahKLRF 326  

                   PSkeeALqIFCrsAFgQnsPpdGFeeL..eAreVtkLaGnLPLGLrVlGS
                    + ee  + F r AF  n  + + e+L++  +e +k +G LPL+  Vl  
  gi|7443912   327 LTFEESWTLFERKAFS-NIEKVD-EDLqrTGKEMVKKCGGLPLAIVVLSG 374  

                   sLRGkskeeWedmLpRLrtsfgnsLDgk...IekvLrvsYDgLhekDqaL
                    L +k  +eW ++   L      +L +++ +I  v   s+ +  ++ +  
  gi|7443912   375 LLSRKRTNEWHEVCASLWR----RLKDNsihISTVFDLSFKEMRHELKLC 420  

                   FLhIACfFN.gekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgne
                   FL+  +f  ++e+  +V++l+              L+    I+ ++    
  gi|7443912   421 FLYFSVFPEdYEI--KVEKLIH------------LLVAEGFIQEDE---- 452  

                   dkvdgtieMHnLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtd
                          eM  + + ++R        id +       LvD      V ++
  gi|7443912   453 -------EM--MMEDVARC------YID-E-------LVDRS---LVKAE 476  

                   nTGtgtrsVlGIslDtseieeelnIsekAFegMrNLqFLriykksfrddg
                    +  g  +V+      ++i +     + A ++   L F ++y+   + + 
  gi|7443912   477 RIERG--KVM-----SCRIHDL--LRDLAIKKAKELNFVNVYNE--KQHS 515  

                   k<-*
                       
  gi|7443912   516 S    516  

gi|8118164|gb|AAF72920.1|: domain 1 of 1, from 2 to 156: score -184.6, E = 0.0038
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                               ++V                   
  gi|8118164     2    -----------------------A-QAV------------------- 5    

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++ +      ++F+ ++F  n+r                ++D ++    
  gi|8118164     6 -YNSIA-----KQFECKCFLHNVR---------------ENSDKHG---L 31   

                   LhLQeqfLSk.I.....LnqkDikIhdHLGvieERLkdqKVLIiLDDVDd
                     LQeq+LSk+I+ ++++++ +  I+     i+ RL+++KVL+iLDDV++
  gi|8118164    32 IYLQEQLLSKsIgfkepFGHVNEGIP----IIRRRLCQKKVLLILDDVNK 77   

                   leQLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeA
                   l+QL +L +e + FG+GSR+I+TT Dk+LL +HgI+  IYe         
  gi|8118164    78 LKQLQVLIGEPSSFGHGSRVIITTRDKHLLSSHGIKK-IYE--------- 117  

                   LqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkske
                                                                G +  
  gi|8118164   118 ---------------------A----------------------YGLN-- 122  

                   eWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFN.g
                     e +L  Lrt                         +a        F ++
  gi|8118164   123 -KEQALELLRT-------------------------KA--------FKsK 138  

                   ekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHn
                   ++         ds                                     
  gi|8118164   139 KN---------DS------------------------------------- 142  

                   LLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlG
                                                              +      
  gi|8118164   143 -------------------------------------------S------ 143  

                   IslDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                           +   +Is +A +          y +          
  gi|8118164   144 -------YD---YISNRAVK----------YAC-------    156  

gi|10177942|dbj|BAB11301.1|: domain 1 of 1, from 153 to 547: score -185.3, E = 0.0042
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                            VG++   e+  s   L + de    G +G  G+GKTT    
  gi|1017794   153    ------VGLDKLVEMAWS--SLMN-DEIGTLGLYGMGGVGKTTLLES 190  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L +++   + +s F   + +  ++  +                    G +
  gi|1017794   191 LNNKFV--ELESEFDVVIWVVVSKDFQ-----------------FE-GIQ 220  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                    +   ++ S        +       i + L  +K  + LDD+   +    
  gi|1017794   221 DQILGRLRSDKEWERETESK-KASLIYNNLERKKFVLLLDDLWSEV---- 265  

                   LAketqWFG.......pGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkee
                      +++  G +++++++GS I+ TT   +  k    + +  +V   S +e
  gi|1017794   266 ---DMTKIGvppptreNGSKIVFTTRSTEVCKHMKADKQ-IKVACLSPDE 311  

                   ALqIFCrsAFgQnsPp..dGFeeLeAreVtkLaGnLPLGLrVlGSsLR.G
                   A + F r   g    +++ +   L Ar V+  +  LPL+L+V G ++   
  gi|1017794   312 AWELF-RLTVGDIILRshQDIPAL-ARIVAAKCHGLPLALNVIGKAMScK 359  

                   kskeeWedmLpRLrtsfgn...sLDgkIekvLrvsYDgLhek.DqaLFLh
                   ++ +eW  ++  L +  g++ ++  ++I  +L++sYD+L + + +  FL+
  gi|1017794   360 ETIQEWSHAINVLNS-AGHefpGMEERILPILKFSYDSLKNGeIKLCFLY 408  

                   IACfFN.gekvdy..VkalLadsnnLD........VrqGLkvLadKSLIh
                      f  + e+ + + ++ ++ +  + ++++ ++++ ++G  +     L++
  gi|1017794   409 CSLFPEdSEIPKEkwIEYWICEG-FINpnryedggTNHGYDIIG--LLVR 455  

                   isplgnedkvdgtieMHnLLqqLGReAIVrkQsidhdePgKRq..FLvDa
                      l ++ ++ + ++MH+  ++++   I       + + gK q+++ v +
  gi|1017794   456 AHLLIEC-ELTDNVKMHDVIREMALW-I-------NSDFGKQQetICVKS 496  

                   eeIcdVLtdnTGtgtrsVlGIslDtseieeelnIsekAFegMrNLqFLri
                           +++  +   V  +s+  + i+    Is ++  + +NL  L i
  gi|1017794   497 GAHVRMIPNDINWE--IVRTMSFTCTQIK---KISCRS--KCPNLSTLLI 539  

                   ykksfrddgk<-*
                    ++  r   k   
  gi|1017794   540 LDN--RLLVK    547  

gi|7489501|pir||T02213: domain 1 of 1, from 36 to 422: score -185.6, E = 0.0043
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVG...IwGPaGIGKTTI
                       D +++V         k LL  ++ + +  V   +I G  G GKTT 
  gi|7489501    36    EDKENIV---------KMLLTPNNSNHA-NVSvlpIVGMGGLGKTTL 72   

                   ARALfs..qLSerhFqssFqls...aFmenlrgsyskeeigSgetrpagl
                       +++++       + Fql+  ++  en  ++          + ++++
  gi|7489501    73 TQLVYNdpRVK-----EYFQLRvwpCVSENFDEMKL-------TKETIES 110  

                   DeYsyGmKLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDV
                      +            S ++   ++  + +L      L  ++ L++LDDV
  gi|7489501   111 VASG-----------FSSVTTNMNLLQE-DL---SKKLEGKRFLLVLDDV 145  

                   ..DdleQLd....ALAketqWFGp.GSRIIVTTeDkqLLkaHgInhtIYe
                    ++d e  d+ + AL+      G++GSRI+VTT +k   k  g     Y 
  gi|7489501   146 wnEDPEKWDryrcALVS-----GSnGSRIVVTTRNKNVGKLMGGMTP-YF 189  

                   VgfPSkeeALqIFCrsAF..gQnsPpdGFeeLeAreVtkLaGnLPLGLrV
                    +  S+ +    F  +AF +g +s +   e +  +e++k    LPL+ + 
  gi|7489501   190 LKQLSENDCWNLFRSYAFadGDSSLHPHLEII-GKEIVKKLKGLPLAAKA 238  

                   lGSsLR.GkskeeWedmLp....RLrtsfgnsLDgkIekvLrvsYDgLhe
                    GS L +  ++++W+++L+++  +L      s   +I   Lr sY+ L  
  gi|7489501   239 IGSLLCtKDTEDDWKNVLRseiwELP-----SDKNNILPALRLSYNHLPA 283  

                   kDqaLFLhIACfFNgekvdyV..kalLadsnnLDVrqGLkvLadKSLIhi
                     +    + A+     k dyV +k+ L           +  L     I+ 
  gi|7489501   284 ILKR---CFAFCSVFHK-DYVfeKETLVQI--------WMALG---FIQ- 317  

                   splgne..................dkvdgtieMHnLLqqLGReAIVrkQs
                   sp+++  ++ +++  ++  +++  ++ +g  +MH+    L+   +   ++
  gi|7489501   318 SPGRRTieelgssyfdellgrsffQHHKGGYVMHDAMHDLAQS-VSMDEC 366  

                   idhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtseieeelnIs
                      +       L D+        + + t+ rs    s+  ++ +++ + +
  gi|7489501   367 L--R-------LDDPP-------NSSSTS-RSSRHLSFSCHNRSRTSFED 399  

                   ekAFegMrNLqFLriykksfrddgk<-*
                      F++ r L+ L+ yk+  r ++    
  gi|7489501   400 FLGFKKARTLLLLNGYKS--RTSPI    422  

gi|8118171|gb|AAF72923.1|: domain 1 of 1, from 2 to 154: score -186.8, E = 0.005
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                               ++V                   
  gi|8118171     2    -----------------------A-QAV------------------- 5    

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++++      + F+  +F  n+r           e++ +   eY     
  gi|8118171     6 -YNLIA-----NEFECLCFLHNVR-----------ENSLKHGLEY----- 33   

                   LhLQeqfLSkILnqkDikIhdHLG....vieERLkdqKVLIiLDDVDdle
                     LQeq+L k ++ k  +   H  ++ + i+ RL+++KVL+iLDD+D+l+
  gi|8118171    34 --LQEQLLFKSIGLK-TQFG-HVNegipIIKRRLCQKKVLLILDDIDKLK 79   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   QL +L++e  W G GSR+I+TT Dk+LL +HgI   IYe           
  gi|8118171    80 QLQVLVGEPGWLGRGSRVIITTRDKHLLSSHGITK-IYE----------- 117  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                                                              G +    
  gi|8118171   118 -------------------A----------------------YGLN---K 123  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                   e +L  L+t        k                       A+  N+++ 
  gi|8118171   124 EQALELLKT--------K-----------------------AFKSNKSD- 141  

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                            s                                        
  gi|8118171   142 ---------S---------------------------------------- 142  

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                                                           +         
  gi|8118171   143 ----------------------------------------S--------- 143  

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                        +   +I                y+      ++   
  gi|8118171   144 ----YD---YI---------------LYRA----VKY    154  

gi|9858473|gb|AAG01049.1|: domain 1 of 1, from 1 to 151: score -188.2, E = 0.0059
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                              k                      
  gi|9858473     1    ------------------------K---------------------- 1    

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                        S                ++                  D       
  gi|9858473     2 -----S---------------DKK------------------DGLE---- 9    

                   LhLQeqfLSkILnqkDikIh....dHLGvieERLkdqKVLIiLDDVDdle
                    hLQ+ +LS+IL+ k+i   +++++    i+ RLk +KVL+iLDDV+   
  gi|9858473    10 -HLQRILLSEILGEKNISLTstqqG-ISIIQSRLKGKKVLLILDDVNTHG 57   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   QL A+     WFGpGS II+TT D qLL  H++n t Ye +   +++ALq
  gi|9858473    58 QLQAIGR-RDWFGPGSKIIITTRDEQLLAYHEVNET-YEMKELNQKDALQ 105  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    +   AF++  +   + e    +V+  a  LPL+L V  S+L Gks    
  gi|9858473   106 LLTWNAFKKEKADPTYVEV-LHRVIAYASGLPLALEVISSHLVGKS---- 150  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                                                                     
  gi|9858473     - -------------------------------------------------- -    

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                                                                     
  gi|9858473     - -------------------------------------------------- -    

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                         I                                           
  gi|9858473   151 ------I------------------------------------------- 151  

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                           
  gi|9858473     - -------------------------------------    -    

gi|11994216|dbj|BAB01338.1|: domain 1 of 1, from 168 to 552: score -188.2, E = 0.0059
                   *->rDFddlVG.iEaHlekmksLLcLds....kdeVrMVGIwGPaGIGKT
                           lVG+ E+ l+  ++LL  d  + +k +V  + + G +G+GKT
  gi|1199421   168    -----LVGrVEDKLALVNLLLSDDEisigKPAV--ISVVGMPGVGKT 207  

                   TIARALfs..qLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglD
                   T   + f++ +       + F+ +  ++             g    ++++
  gi|1199421   208 TLTEIVFNdyRVT-----EHFEVKMWIS------------AG----INFN 236  

                   eYsyGmKLhLQeqfLSkILnqkD...ikIhdHLGvieERLkdqKVLIiLD
                         K  LQ    S + n +D ++++I      ++  L  ++ L++LD
  gi|1199421   237 VFT-VTKAVLQDITSSAV-NTEDlpsLQIQ-----LKKTLSGKRFLLVLD 279  

                   DV........DdleQLdALAketqWFGpGSRIIVTTeDkqLLkaHgInht
                   D  ++++++ +  ++  + A        GS I+ TT           +  
  gi|1199421   280 DFwsesdsewESFQVAFTDAE------EGSKIVLTTRSEIVSTVAKAEK- 322  

                   IYeVgfPSkeeALqIFCrsAFgQn...sPpdGFeeLeAreVtkLaGnLPL
                   IY+ ++ ++ee  +   r AFg  + +s     e +  +++++ +  LPL
  gi|1199421   323 IYQMKLMTNEECWELISRFAFGNIsvgSINQELEGI-GKRIAEQCKGLPL 371  

                   GLrVlGSsLR.GkskeeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhe
                   + r   S+LR+  + ++W  +   + +      +  I  vL+ sYD+L  
  gi|1199421   372 AARAIASHLRsKPNPDDWYAVSKNFSS----YTNS-ILPVLKLSYDSLPP 416  

                   kDqaLFLhIACfFNgekvdyVkalLadsnnLDVrqG..............
                   + +  F +  +f  g   d+ +  L      D  + ++++++ ++ +++ 
  gi|1199421   417 QLKRCFALCSIFPKGHVFDREELVLLWM-AIDLLYQprssrrledigndy 465  

                   LkvLadKSLIhisplgnedkvdgtieMHnLLqqLGReAIVrkQsidhdeP
                   L  L+  S  +  + +         +MH+L   L++  +           
  gi|1199421   466 LGDLVAQSFFQRLDIT-----MTSFVMHDLMNDLAKA-V----------- 498  

                   gKRqFLvDaeeIcdVLtdn......TGtgtrsVlGIslDtseieeelnIs
                           + + c  L+d++ ++ ++ t+       ++  s+ ++  ++ 
  gi|1199421   499 --------SGDFCFRLEDDnipeipSTTR-------HFSFSRSQCDASV- 532  

                   ekAFegMrNLqFLriykksfrddgk<-*
                     AF+ ++   FLr       +  +   
  gi|1199421   533 --AFRSICGAEFLRTILP---FNSP    552  

gi|8118162|gb|AAF72919.1|: domain 1 of 1, from 3 to 156: score -188.6, E = 0.0062
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                              k  V                   
  gi|8118162     3    ------------------------K-SV------------------- 5    

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++ +      ++F+ ++F  n+r                ++D ++    
  gi|8118162     6 -YNSIA-----KQFECKCFLHNVR---------------ENSDKHG---L 31   

                   LhLQeqfLSkILnqkDi..kIhdHLGvieERLkdqKVLIiLDDVDdleQL
                     LQeq+LSk ++ k   + +++    i+ RL+++KVL+iLDDV++l+QL
  gi|8118162    32 IYLQEQLLSKSIGFKERfgHVNEGIPIIRRRLCQKKVLLILDDVNKLKQL 81   

                   dALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIF
                    +L +e + FG+GSR+I+TT Dk+LL +HgI+  IYe             
  gi|8118162    82 QVLIGEPSSFGHGSRVIITTRDKHLLSSHGIKK-IYE------------- 117  

                   CrsAFgQnsPpdGFeeL.eAreVtkLaGnLPLGLrVlGSsLRGkskeeWe
                              dG   L+e                              e
  gi|8118162   118 ----------ADG---LnE------------------------------E 124  

                   dmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvd
                    +L  Lrt        k                       A+  N+ +  
  gi|8118162   125 QALELLRT--------K-----------------------AFKSNKND-- 141  

                   yVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqq
                           s                                         
  gi|8118162   142 --------S----------------------------------------- 142  

                   LGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslD
                     R                                               
  gi|8118162   143 --RY---------------------------------------------- 144  

                   tseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                       +   +I  +A +          y +          
  gi|8118162   145 ----D---YILNRAIK----------YAS-------    156  

gi|8517418|emb|CAB94290.1|: domain 1 of 1, from 1 to 161: score -188.8, E = 0.0063
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                                T A+A
  gi|8517418     1    ------------------------------------------TLAKA 5    

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++  S      sF+ + F en                  ++   +   K
  gi|8517418     6 AYNEYS-----YSFEGTSFLENFG---------------ENFKKPQ--GK 33   

                   LhLQeqfLSkILnqkDikIhdHLG.vieERLkdqKVLIiLDDVDdleQLd
                    hLQ+++LS IL+  Di  + +  ++++ R ++++VL++LD V+d++QL 
  gi|8517418    34 VHLQQKLLSDILRRHDIVFN-NMDhAVKHRFRNKRVLVVLDNVEDVKQLH 82   

                   ALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALqIFC
                     A + ++FGpGSRII+T  +k+LL++ g+ + IY  +    +e L+   
  gi|8517418    83 STAIDWSCFGPGSRIIITSRNKHLLEQLGVVN-IYSPDALNGKESLELVS 131  

                   rsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedm
                    + F+   Pp +F +L +++ ++ +G +P                     
  gi|8517418   132 WHSFRTEKPPADFRQL-SEKLVEYCGGFP--------------------- 159  

                   LpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekvdyV
                                                                     
  gi|8517418     - -------------------------------------------------- -    

                   kalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLG
                                                                     
  gi|8517418   160 ---------------------------F---------------------- 160  

                   ReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDts
                     A                                               
  gi|8517418   161 --A----------------------------------------------- 161  

                   eieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                        
  gi|8517418     - ----------------------------------    -    

gi|14348616|gb|AAK61316.1|AF306500_1: domain 1 of 1, from 176 to 594: score -188.9, E = 0.0064
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      rD +  + i     +++     +  +   +  I G  G GKTT A  
  gi|1434861   176    RDAEKNIIINWLTSEIE-----NP-NHPSILSIVGMGGLGKTTLAQH 216  

                   Lfs..qLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyG
                    +s++++       +F  +a +  ++                   ++   
  gi|1434861   217 VYSdpKIED----AKFDIKAWVC-VS-------------------DHF-- 240  

                   mKLhLQeqfLSkILnqkD....ikIhdHLGvieERLkdqKVLIiLDDVDd
                     L   +  L  I+nq+D++++++   H   ++E L  ++ L++LDDV +
  gi|1434861   241 HVLTVTRTILEAITNQNDdsgnLEMV-HK-KLKEKLLGKRFLLVLDDVWN 288  

                   leQLdALAketqW........FG.pGSRIIVTTe..........DkqLLk
                             ++W+  +++ ++G pGSRI  TT +++  ++ ++  +LLk
  gi|1434861   289 ER-------PAEWeavrtplsYGaPGSRILFTTRsekvassmrsEVHLLK 331  

                   aHgInhtIYeVgfPSkeeALqIFCrsAFgQnsPpdGFeeLeAreVtkLaG
                   + g +    +V    + +AL+       g     d  ++   r++++ + 
  gi|1434861   332 QLGEDE-CWKVF---ENHALKD------GDLELNDELMKV-GRRIVEKCK 370  

                   nLPLGLrVlGSsLR.GkskeeWedmLp....RLrtsfgnsLDgkIekvLr
                    LPL+L+  G  L +  s  +W+++L ++  +L +      + +I   L 
  gi|1434861   371 GLPLALKTIGCLLStKSSISDWKNILEsdiwELPK-----EHSEIIPALF 415  

                   vsYDgLhekDqaLFLhIACf...FNgekvdyVkalLadsnnL....DVrq
                    sY  L ++ +  F + A f+++    k +++  + a + +L +++ +r+
  gi|1434861   416 LSYRHLPSHLKRCFAYCALFpkdYKFVKEELIFLWMAQN-FLlspqQIRH 464  

                   .......GLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGReAIVrk
                   +++ +++ ++ L  ++  + s+        g+ +MH+LL  L++   V++
  gi|1434861   465 peevgeeYFNDLLSRCFFNQSSF------VGRFVMHDLLNDLAKY--VCA 506  

                   ...........QsidhdePgKRqFLvDaeeI.....cdVLtdnTGtgtrs
                   +   + + ++ Q+i       R+F +++++ ++ ++ + Ltd++  +  s
  gi|1434861   507 dfcfrlkydkcQCI---PKTTRHFSFEFRDVesfdgFESLTDAKRLR--S 551  

                   VlGIs.lDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   +l Is+l   +   +++I  + F ++   + L+++ +++ ++ +   
  gi|1434861   552 FLPISkLWEPKWHFKISI-HDLFSKIKFIRVLSFNGCLDLREVP    594  

gi|8118183|gb|AAF72927.1|: domain 1 of 1, from 1 to 156: score -189.1, E = 0.0065
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                                  ARA
  gi|8118183     1    -----------------------L--------------------ARA 4    

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++ +      ++F   +F  n+r           e++++   e      
  gi|8118183     5 VYNSIA-----DQFDCLCFLHNVR-----------ENSEKHGLE------ 32   

                   LhLQeqfLSkILnqkDikIhdHLG....vieERLkdqKVLIiLDDVDdle
                    hLQ+ fLSk  +  D   + +  ++ + i++RL+++KVL+iLDDV+ l+
  gi|8118183    33 -HLQNDFLSKTVGL-DFNLR-DSSegipIIKQRLHQKKVLLILDDVNELK 79   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   QL+AL++   WF  GSR+I+TT Dk+LL  HgI  t Ye +         
  gi|8118183    80 QLEALVGAHDWFSVGSRVIITTRDKHLLTTHGIGIT-YEID--------- 119  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                                    eL                               
  gi|8118183   120 -----------------EL-----------------------------NK 123  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                   e++L  +r+                         +a        F +++v
  gi|8118183   124 EEALELIRS-------------------------KA--------FKCKNV 140  

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                   d   +++ +                                         
  gi|8118183   141 DSSYEYILNR---------------------------------------- 150  

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                        A                                            
  gi|8118183   151 -----A-------------------------------------------- 151  

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                       ++                     y +          
  gi|8118183   152 ----VS---------------------YAS-------    156  

gi|3426261|gb|AAC32253.1|: domain 1 of 1, from 471 to 818: score -189.4, E = 0.0068
                   *->rDFddlVGiEaHlekmksLLc.Lds...kdeVrMVGIwGPaGIGKTT
                            VG E   e+ +++L++L s++ + +V  + I G +G GKTT
  gi|3426261   471    ------VGFE---EETNLILRkLTSgsaDLDV--ISITGMPGSGKTT 506  

                   IARALfs..qLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDe
                    A   ++++  S     s+F l+a  + +                 g De
  gi|3426261   507 LAYKVYNdkSVS-----SRFDLRAWCT-VD---------------QGCDE 535  

                   YsyGmKLhLQeqfLSkILnq.........kDikIhdHLGvieERLkdqKV
                             +++L  I+ q ++++++ +++i + d    ++  L  ++ 
  gi|3426261   536 ----------KKLLNTIFSQvsdsdsklsENIDVAD---KLRKQLFGKRY 572  

                   LIiLDDVDdleQLdALAketqWFGp......GSRIIVTTeDkqLLkaHg.
                   LI+LDDV d    d L        p +++++GSRII TT  k+    Hg+
  gi|3426261   573 LIVLDDVWDTTTWDELTR------PfpeskkGSRIILTTREKEV-ALHGk 615  

                   InhtIYeVgfPSkeeALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLP
                    n       +   +e  + +   AFg  s pd   +   +e+++ +  LP
  gi|3426261   616 LNTDPLDLRLLRPDESWELLEKRAFGNESCPDELLDV-GKEIAENCKGLP 664  

                   LGLrVlGSsLRGkskee..WedmLpRLrtsfgnsLDgkIekvLrvsYDgL
                   L          G+ k+++ W ++   L + f      +++kv   sYD L
  gi|3426261   665 LVADLIAGVIAGREKKRsvWLEVQSSLSS-FILNSEVEVMKVIELSYDHL 713  

                   hekDqaLFLhIACfFNgekvdyVkalLadsnnLDVrqGLkvLadKSLIhi
                    ++ +   L+ A f            L     L+V +G +  +       
  gi|3426261   714 PHHLKPCLLYFASFPKDTS-------LTIY-ELNVYFGAEGFV------- 748  

                   splgnedkvdgtieMHnLLqqLGReAIVrkQsidhdePgKRqFLvDaeeI
                             g  eM n  +++  + I     i+          + ++eI
  gi|3426261   749 ----------GKTEM-NSMEEVV-K-IYMDDLIY------SSLVICFNEI 779  

                   cdVLtdnTGtgtrsVlGIslDtseieeelnIsekAFegMrNLqFLriykk
                    + L+  + +          D + i+      e+ F+ +r         +
  gi|3426261   780 GYALNFQIHDL-------VHDFCLIK---ARKENLFDQIR--------SS 811  

                   sfrddgk<-*
                     +d  +   
  gi|3426261   812 APSDLLP    818  

gi|7489037|pir||T06267: domain 1 of 1, from 522 to 869: score -189.4, E = 0.0068
                   *->rDFddlVGiEaHlekmksLLc.Lds...kdeVrMVGIwGPaGIGKTT
                            VG E   e+ +++L++L s++ + +V  + I G +G GKTT
  gi|7489037   522    ------VGFE---EETNLILRkLTSgsaDLDV--ISITGMPGSGKTT 557  

                   IARALfs..qLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDe
                    A   ++++  S     s+F l+a  + +                 g De
  gi|7489037   558 LAYKVYNdkSVS-----SRFDLRAWCT-VD---------------QGCDE 586  

                   YsyGmKLhLQeqfLSkILnq.........kDikIhdHLGvieERLkdqKV
                             +++L  I+ q ++++++ +++i + d    ++  L  ++ 
  gi|7489037   587 ----------KKLLNTIFSQvsdsdsklsENIDVAD---KLRKQLFGKRY 623  

                   LIiLDDVDdleQLdALAketqWFGp......GSRIIVTTeDkqLLkaHg.
                   LI+LDDV d    d L        p +++++GSRII TT  k+    Hg+
  gi|7489037   624 LIVLDDVWDTTTWDELTR------PfpeskkGSRIILTTREKEV-ALHGk 666  

                   InhtIYeVgfPSkeeALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLP
                    n       +   +e  + +   AFg  s pd   +   +e+++ +  LP
  gi|7489037   667 LNTDPLDLRLLRPDESWELLEKRAFGNESCPDELLDV-GKEIAENCKGLP 715  

                   LGLrVlGSsLRGkskee..WedmLpRLrtsfgnsLDgkIekvLrvsYDgL
                   L          G+ k+++ W ++   L + f      +++kv   sYD L
  gi|7489037   716 LVADLIAGVIAGREKKRsvWLEVQSSLSS-FILNSEVEVMKVIELSYDHL 764  

                   hekDqaLFLhIACfFNgekvdyVkalLadsnnLDVrqGLkvLadKSLIhi
                    ++ +   L+ A f            L     L+V +G +  +       
  gi|7489037   765 PHHLKPCLLYFASFPKDTS-------LTIY-ELNVYFGAEGFV------- 799  

                   splgnedkvdgtieMHnLLqqLGReAIVrkQsidhdePgKRqFLvDaeeI
                             g  eM n  +++  + I     i+          + ++eI
  gi|7489037   800 ----------GKTEM-NSMEEVV-K-IYMDDLIY------SSLVICFNEI 830  

                   cdVLtdnTGtgtrsVlGIslDtseieeelnIsekAFegMrNLqFLriykk
                    + L+  + +          D + i+      e+ F+ +r         +
  gi|7489037   831 GYALNFQIHDL-------VHDFCLIK---ARKENLFDQIR--------SS 862  

                   sfrddgk<-*
                     +d  +   
  gi|7489037   863 APSDLLP    869  

gi|2443883|gb|AAB71476.1|: domain 1 of 1, from 149 to 551: score -190.8, E = 0.008
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      r     +G E  l+k     +L   d+V + G  G  G+GKTT  + 
  gi|2443883   149    RPTQPTIGQEEMLKKAWN--RLME-DGVGIMGLHGMGGVGKTTLFKK 192  

                   LfsqLSerhFq.ssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGm
                    ++++ e    +  F   + +  + g              + l e     
  gi|2443883   193 IHNKFAE---TgGTFDIVIWIVVSQG-----------AKLSKLQED-IAE 227  

                   KLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLd
                   KLhL        L ++  + +     i   Lk ++  + LDD+   + L+
  gi|2443883   228 KLHLCDD-----LWKNKNESD-KATDIHRVLKGKRFVLMLDDIWEKVDLE 271  

                   AL.......AketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSke
                   A++ + +++++          +  TT D++   + g      +V+    e
  gi|2443883   272 AIgipypseVN-------KCKVAFTTRDQKVCGQMGDHKP-MQVKCLEPE 313  

                   eALqIFCrsAFgQnsPpdG..FeeLeAreVtkLaGnLPLGLrVlGSsLRG
                   +A + F     g n+ + ++    L AreV+  +  LPL+L+  G  +  
  gi|2443883   314 DAWELF-KNKVGDNTLRSDpvIVGL-AREVAQKCRGLPLALSCIGETMAS 361  

                   ksk.eeWedmLpRLrtsfg..nsLDgkIekvLrvsYDgLhek.DqaLFLh
                   k+  +eWe ++  L  s  +      kI  +L+ sYD+L +++ ++ FL+
  gi|2443883   362 KTMvQEWEHAIDVLTRSAAefSDMQNKILPILKYSYDSLEDEhIKSCFLY 411  

                   IACfFNgekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgne....
                    A f    k         d+         k+L +K +     ++++  ++
  gi|2443883   412 CALFPEDDK--------IDT---------KTLINKWICEGFIGEDQvikr 444  

                   .....................d.kvdgtieMHnLLqqLGReAIVrk...Q
                    ++++ +  ++  + +  +++ + v+ +++MH+  ++++   I    ++Q
  gi|2443883   445 arnkgyemlgtliranlltndRgFVKWHVVMHDVVREMALW-IASDfgkQ 493  

                   sidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtseieeelnI
                   +  ++  + R   v  +eI  V + +   +      +sl ++eie e+  
  gi|2443883   494 KE-NYVVRAR---VGLHEIPKVKDWGAVRR------MSLMMNEIE-EITC 532  

                   sekAFegMrNLqFLriykksfrddgk<-*
                   + k     + L  L    +     ++   
  gi|2443883   533 ESKC----SELTTLFLQSN---QLKN    551  

gi|7489071|pir||T07872: domain 1 of 1, from 471 to 832: score -191.3, E = 0.0085
                   *->rDFddlVGiEaHlekmksLLc.Lds...kdeVrMVGIwGPaGIGKTT
                           +VG E   e+ +++L++L s++ + +V  + I G +G GKTT
  gi|7489071   471    -----IVGFE---EETNLILRkLTSgpaDLDV--ISITGMPGSGKTT 507  

                   IARALfs..qLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDe
                    A   ++++  S     + F l+a  + +                 g D+
  gi|7489071   508 LAYKVYNdkSVS-----RHFDLRAWCT-VD---------------QGYDD 536  

                   YsyGmKLhLQeqfLSkILnq.........kDikIhdHLGvieERLkdqKV
                             +++L  I+ q ++++++ +++i + d    ++  L  ++ 
  gi|7489071   537 ----------KKLLDTIFSQvsgsdsnlsENIDVAD---KLRKQLFGKRY 573  

                   LIiLDDVDdleQLdAL......AketqWFGpGSRIIVTTeDkqLLkaHg.
                   LI+LDDV d   Ld L+++ ++Ak       GSRII TT  k+    Hg+
  gi|7489071   574 LIVLDDVWDTTTLDELtrpfpeAK------KGSRIILTTREKEV-ALHGk 616  

                   InhtIYeVgfPSkeeALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLP
                    n       +   +e  + +    Fg  s pd   +   +e+++ +  LP
  gi|7489071   617 LNTDPLDLRLLRPDESWELLEKRTFGNESCPDELLDV-GKEIAENCKGLP 665  

                   LGLrVlGSsLRGkskee..WedmLpRLrtsfgnsLDgkIekvLrvsYDgL
                   L          G+ k+++ W ++   L + f      +++kv   sYD L
  gi|7489071   666 LVADLIAGVIAGREKKRsvWLEVQSSLSS-FILNSEVEVMKVIELSYDHL 714  

                   hekDqaLFLhIACfFN.gekvdyVkalLadsnnLDVrqGLkvLadKSLIh
                    ++ +   Lh    F +  k++ ++ +L  +    V +G +  ++K    
  gi|7489071   715 PHHLKPCLLH----FAsWPKDTPLTIYLL-T----VYLGAEGFVEK---- 751  

                   isplgnedkvdgtieMHnLLqqLGReAIVrkQsidhdePgKRqFLvDaee
                    +++g e                  e +V       d+       + ++e
  gi|7489071   752 TEMKGIE------------------E-VVKIYM---DDLISSSLVICFNE 779  

                   IcdVLtdnTGtgtrsVlGIslDtseieeelnIsekAFegMr.....NLqF
                   I d+L+  + +          D + i+      e+ F+++r++ +++L+ 
  gi|7489071   780 IGDILNFQIHDL-------VHDFCLIK---ARKENLFDRIRssapsDLLP 819  

                   Lriykksfrddgk<-*
                     i  +++  +++   
  gi|7489071   820 RQITIDYDEEEEH    832  

gi|4050014|gb|AAC97933.1|: domain 1 of 1, from 522 to 883: score -191.3, E = 0.0085
                   *->rDFddlVGiEaHlekmksLLc.Lds...kdeVrMVGIwGPaGIGKTT
                           +VG E   e+ +++L++L s++ + +V  + I G +G GKTT
  gi|4050014   522    -----IVGFE---EETNLILRkLTSgpaDLDV--ISITGMPGSGKTT 558  

                   IARALfs..qLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDe
                    A   ++++  S     + F l+a  + +                 g D+
  gi|4050014   559 LAYKVYNdkSVS-----RHFDLRAWCT-VD---------------QGYDD 587  

                   YsyGmKLhLQeqfLSkILnq.........kDikIhdHLGvieERLkdqKV
                             +++L  I+ q ++++++ +++i + d    ++  L  ++ 
  gi|4050014   588 ----------KKLLDTIFSQvsgsdsnlsENIDVAD---KLRKQLFGKRY 624  

                   LIiLDDVDdleQLdAL......AketqWFGpGSRIIVTTeDkqLLkaHg.
                   LI+LDDV d   Ld L+++ ++Ak       GSRII TT  k+    Hg+
  gi|4050014   625 LIVLDDVWDTTTLDELtrpfpeAK------KGSRIILTTREKEV-ALHGk 667  

                   InhtIYeVgfPSkeeALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLP
                    n       +   +e  + +    Fg  s pd   +   +e+++ +  LP
  gi|4050014   668 LNTDPLDLRLLRPDESWELLEKRTFGNESCPDELLDV-GKEIAENCKGLP 716  

                   LGLrVlGSsLRGkskee..WedmLpRLrtsfgnsLDgkIekvLrvsYDgL
                   L          G+ k+++ W ++   L + f      +++kv   sYD L
  gi|4050014   717 LVADLIAGVIAGREKKRsvWLEVQSSLSS-FILNSEVEVMKVIELSYDHL 765  

                   hekDqaLFLhIACfFN.gekvdyVkalLadsnnLDVrqGLkvLadKSLIh
                    ++ +   Lh    F +  k++ ++ +L  +    V +G +  ++K    
  gi|4050014   766 PHHLKPCLLH----FAsWPKDTPLTIYLL-T----VYLGAEGFVEK---- 802  

                   isplgnedkvdgtieMHnLLqqLGReAIVrkQsidhdePgKRqFLvDaee
                    +++g e                  e +V       d+       + ++e
  gi|4050014   803 TEMKGIE------------------E-VVKIYM---DDLISSSLVICFNE 830  

                   IcdVLtdnTGtgtrsVlGIslDtseieeelnIsekAFegMr.....NLqF
                   I d+L+  + +          D + i+      e+ F+++r++ +++L+ 
  gi|4050014   831 IGDILNFQIHDL-------VHDFCLIK---ARKENLFDRIRssapsDLLP 870  

                   Lriykksfrddgk<-*
                     i  +++  +++   
  gi|4050014   871 RQITIDYDEEEEH    883  

gi|7489072|pir||T06269: domain 1 of 1, from 522 to 860: score -191.8, E = 0.009
                   *->rDFddlVGiEaHlekmksLLc.Lds...kdeVrMVGIwGPaGIGKTT
                           +VG E   e+ +++L++L s++ + +V  + I G +G GKTT
  gi|7489072   522    -----IVGFE---EETNLILRkLTSgpaDLDV--ISITGMPGSGKTT 558  

                   IARALfs..qLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDe
                    A   ++++  S     + F l+a  + +                 g D+
  gi|7489072   559 LAYKVYNdkSVS-----RHFDLRAWCT-VD---------------QGYDD 587  

                   YsyGmKLhLQeqfLSkILnq.........kDikIhdHLGvieERLkdqKV
                             +++L  I+ q ++++++ +++i + d    ++  L  ++ 
  gi|7489072   588 ----------KKLLDTIFSQvsgsdsnlsENIDVAD---KLRKQLFGKRY 624  

                   LIiLDDVDdleQLdAL......AketqWFGpGSRIIVTTeDkqLLkaHg.
                   LI+LDDV d   Ld L+++ ++Ak       GSRII TT  k+    Hg+
  gi|7489072   625 LIVLDDVWDTTTLDELtrpfpeAK------KGSRIILTTREKEV-ALHGk 667  

                   InhtIYeVgfPSkeeALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLP
                    n       +   +e  + +    Fg  s pd   +   +e+++ +  LP
  gi|7489072   668 LNTDPLDLRLLRPDESWELLDKRTFGNESCPDELLDV-GKEIAENCKGLP 716  

                   LGLrVlGSsLRGkskee..WedmLpRLrtsfgnsLDgkIekvLrvsYDgL
                   L          G+ k+++ W ++   L + f      +++kv   sYD L
  gi|7489072   717 LVADLIAGVIAGREKKRsvWLEVQSSLSS-FILNSEVEVMKVIELSYDHL 765  

                   hekDqaLFLhIACfFNgekvdyVkalLadsnnLDVrqGLkvLadKSLIhi
                    ++ +       C+ +         +  d+           L+    I  
  gi|7489072   766 PHHLKP------CLLHFAS------WPKDT----------PLT----IYL 789  

                   splgnedkvdgtieMHnLLqqLGReAIVrkQsidhdePgKRqFLvDaeeI
                    +                 + LG e  V k +               ee 
  gi|7489072   790 FT-----------------VYLGAEGFVEKTEMK-----------GIEEV 811  

                   cdVLtdnTGtgtrsVlGIslD.tseieeelnIsekAFegMrNLqFLriyk
                     +  d+  ++  s   I ++++  i   + I++ +    +++   +  k
  gi|7489072   812 VKIYMDDLISS--SLV-ICFNeIGDIL-NFQIHDLV----HDFCLIKARK 853  

                   ksfrddgk<-*
                     + +d     
  gi|7489072   854 E-NLFDRI    860  

gi|5454205|gb|AAD43620.1|AC005698_19: domain 1 of 1, from 153 to 552: score -191.8, E = 0.009
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                           +VG +  l k     +L   d+  + G +G  G+GKTT    
  gi|5454205   153    -----IVGQKKMLDKAWK--HLME-DGTGIMGMYGMGGVGKTTLLTQ 191  

                   LfsqLSerhFq.ssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGm
                   Lf+ + +   ++  F   + +  + +          e++    De     
  gi|5454205   192 LFNMFNK---DkCGFDIGIWVVVSQEVNV-------EKIQ---DEIA--Q 226  

                   KLhLQeqfLSkILnqkDikIhdHLGv.ieERLkdqKVLIiLDDV.DdleQ
                   KL L  +   + +  +   I+ + Gv++ + Lk++K  ++LDD+ D++e 
  gi|5454205   227 KLGLGGH---EWTQRD---IS-QKGVhLFNFLKNKKFVLFLDDLwDKVE- 268  

                   LdALAketqWFGpGSRIIVT....TeD..kqLLkaHgInhtIYeVgfPSk
                      LA+           I +++++T+ + k  + +   n      g   +
  gi|5454205   269 ---LAN-----------IGVpdprTQKgcKLAFTSRSLNV-CTSMG---D 300  

                   eeALqIFCrs...AF.......gQnsPp..dGFeeLeAreVtkLaGnLPL
                   ee ++  C+ ++ AF+  +++ gQ++  ++ G  +L Ar V+k +  LPL
  gi|5454205   301 EEPMEVQCLEenvAFdlfqkkvGQKTLGsdPGIPQL-ARIVAKKCCGLPL 349  

                   GLrVlGSsLR.GkskeeWedmLpRLrtsfg...nsLDgkIekvLrvsYDg
                   +L+V G  +   ++ +eW ++++ L + +  + ++  +kI   L+ sYD 
  gi|5454205   350 ALNVIGETMScKRTIQEWRNAIHVLNS-YAaefIGMEDKILPLLKYSYDN 398  

                   Lhek.DqaLFLhIACf...FNgekvdyVkalLadsnnLDVrqGLkvLadK
                   L  ++ ++  L+ A  +++   +k d+++ ++ +    D + G +   dK
  gi|5454205   399 LKGEhVKSSLLYCALYpedAKIRKEDLIEHWICEE-IIDGSEGIEKAEDK 447  

                   ......SLIhisplgned.kv.dgtieMHnLLqqLGReAIVrkQsidhde
                   + +  +SL++ s l ++++  ++  + MH+  ++++   I  + + +   
  gi|5454205   448 gydiigSLVRASLLMECVdLKgKSSVIMHDVVREMALW-I--ASELG--- 491  

                   PgKRqFL....vDaeeIcdVLtdnTGtgtrsVlGIslDtseieeelnIse
                     K  F  + +v  +eI  V + n   +          +s ++++++   
  gi|5454205   492 IQKEAFIvragVGVREIPKVKNWNVVRR----------MSLMGNKIHHLV 531  

                   kAFegMrNLqFLriykksfrddgk<-*
                    + e M  L  L   +    +      
  gi|5454205   532 GSYECME-LTTLLLGEG--EYGSI    552  

gi|3056600|gb|AAC13911.1|AAC13911: domain 1 of 1, from 37 to 461: score -192.3, E = 0.0095
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      r     +G E  lek     +L   d V + G  G  G+GKTT  + 
  gi|3056600    37    RPTQPTIGQEEMLEKAWN--RLME-DRVGIMGLHGMGGVGKTTLFKK 80   

                   Lfs...qLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsy
                    +++  + S     s+F   + +  ++g              + l e   
  gi|3056600    81 IHNkfaKMS-----SRFDIVIWIVVSKG-----------AKLSKLQED-I 113  

                   GmKLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQ
                     KLhL        L ++  + +     i   Lk ++  + LDD+   + 
  gi|3056600   114 AEKLHLCDD-----LWKNKNESD-KATDIHRVLKGKRFVLMLDDIWEKVD 157  

                   LdAL.......AketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPS
                   L+A++ + +++++          +  TT D++     g      +V+   
  gi|3056600   158 LEAIgvpypseVN-------KCKVAFTTRDQKVCGEMGDHKP-MQVKCLE 199  

                   keeALqIFCrsAFgQnsPpdG..FeeLeAreVtkLaGnLPLGLrVlGSsL
                    e+A + F     g n+ + ++   eL AreV+  +  LPL+L+V G  +
  gi|3056600   200 PEDAWELF-KNKVGDNTLRSDpvIVEL-AREVAQKCRGLPLALSVIGETM 247  

                   RGksk.eeWedmLpRLrtsfg..nsLDgkIekvLrvsYDgLhek.DqaLF
                     k+  +eWe ++  L  s  +      kI  +L+ sYD+L +++ ++ F
  gi|3056600   248 ASKTMvQEWEHAIDVLTRSAAefSNMGNKILPILKYSYDSLGDEhIKSCF 297  

                   LhIACfFN.gekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgne.
                   L+ A f  + e+  y ++l+                    I     g+++
  gi|3056600   298 LYCALFPEdDEI--YNEKLIDYW-----------------ICEGFIGEDq 328  

                   ......................dkv.dgtieMHnLLqqLGReAIVrk...
                     ++ ++++ +  ++ +  +   kv+ ++++MH+  ++++   I    ++
  gi|3056600   329 vikrarnkgyemlgtltlanllTKVgTEHVVMHDVVREMALW-IASDfgk 377  

                   .................QsidhdePgKRqFLvDaeeIcdVLtdnTGtgtr
                   ++++   + + + +++++ +d      R  L+D + I ++  + + ++  
  gi|3056600   378 qkenfvvrarvglherpEAKD-WGAVRRMSLMDNH-IEEITCESKCSE-- 423  

                   sVlGIslDtseiee.el.nIsekAFegMrNLqFLriykksfrddgk<-*
                         l t  ++ ++l+n s +  + M  L  L    +  rd +k   
  gi|3056600   424 ------LTTLFLQSnQLkNLSGEFIRYMQKLVVLDLSYN--RDFNK    461  

gi|9711875|dbj|BAB07969.1|: domain 1 of 1, from 329 to 686: score -192.8, E = 0.01
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                        F ++        + ks L L        VGI    G+GKTT    
  gi|9711875   329    TKFSNI------QNRYKSFLVLPV------VGI---GGVGKTTLVQY 360  

                   LfsqLSerhFq.ssFqlsa......FmenlrgsyskeeigSgetrpaglD
                    ++ L         F+ +a    ++F + ++             +  ++D
  gi|9711875   361 VYNDLA----TiTCFEVRAwacvsgFLD-VKQVT--------IDILQSID 397  

                   eYsyGmKLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDV.
                   e +       ++qf S  L  ++i+       +   Lk +K LI+LDDV 
  gi|9711875   398 EEG-------HNQFISS-LSLNNIQTM-----LVKKLKKRKFLIVLDDVw 434  

                   ..DdleQLdA.LAketqWFGpGSRIIVTTeDkqLLkaHgInht...IYeV
                   +  + e+L A+L   t    pGS II+TT      + H+I +t ++I  V
  gi|9711875   435 scSNWELLCApLSSGT----PGSKIIITT------RHHNIANTvgtIPSV 474  

                   gfPSkeeA..LqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVl
                    +   ++ +    F + AFg     d  + +  r+++      PL+ +  
  gi|9711875   475 ILGGLQDSpfWSFFKQNAFGDANMVDNLNLI-GRKIASKLNGIPLAAKTI 523  

                   GSsLRG.kskeeWedmLp....RLrtsfgnsLDgkIekvLrvsYDgL...
                   G  L+ + + e W+ +L ++  +Lr        ++I+ vL  sY  L+ +
  gi|9711875   524 GKLLHKqLTTEHWMSILDsnlwELRQ-----GPEDIMPVLLLSYQHLpan 568  

                   .................hekDqaLFLhIACfFNgekvdyVkalLadsnnL
                    ++     +  +++ + +e++  +F   A  F ++   +  + L+d+   
  gi|9711875   569 iqrcfvfcsafpkdysfCEEE-LIFSWMAHGFIQCM--RRDKTLEDT--- 612  

                   DVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGReAIVrkQsi
                     r  L  La  S  ++s++      d   +MH+LL  L+       +++
  gi|9711875   613 -AREYLYELASASFFQVSSN------DNLYRMHDLLHDLASS-LSKDECF 654  

                   dhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtseieeelnIse
                                             t+              +   n  e
  gi|9711875   655 -------------------------TTS--------------D---NLPE 662  

                   kAFegMrNLqFLriykksfrddgk<-*
                      +  r L FL+ +  +f +++    
  gi|9711875   663 GIPDVVRHLYFLSPDHAKFFRHKF    686  

gi|7443911|pir||T01899: domain 1 of 1, from 167 to 578: score -192.9, E = 0.01
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                          +L   d+V   G +G  G+GKTT    
  gi|7443911   167    --------------------RLMD-DGVGTMGLYGMGGVGKTTLLTQ 192  

                   LfsqLSerhFq.ssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGm
                    ++ L+    ++++  + ++   ++         S   +++   + +   
  gi|7443911   193 IHNTLH----DtKNGVDIVIWVVVS---------SDLQIHKIQEDIG--E 227  

                   KL.....hLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDd
                   KL+  ++ + ++  S    qk + I  ++      L  ++  + LDD+ +
  gi|7443911   228 KLgfigkEWNKKQES----QKAVDIL-NC------LSKKRFVLLLDDIWK 266  

                   leQLd..ALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSke
                    + L +  +  +t+   +   ++ TT         g+ +   eV   S+ 
  gi|7443911   267 KVDLTkiGIPSQTR--ENKCKVVFTTRSLDVCARMGVHDP-MEVQCLSTN 313  

                   eALqIFCrsAFgQnsP..pdGFeeLeAreVtkLaGnLPLGLrVlGSsLRG
                   +A + F +   gQ s +++ +  eL A++V+  +  LPL+L+V G  + G
  gi|7443911   314 DAWELF-QEKVGQISLgsHPDILEL-AKKVAGKCRGLPLALNVIGETMAG 361  

                   .kskeeWedmLpRLrtsfg...nsLDgkIekvLrvsYDgLhek.DqaLFL
                   ++  +eW  +   L + +  +  + D+ I  +L+ sYD L++k+  + F 
  gi|7443911   362 kRAVQEWHHAVDVLTS-YAaefSGMDDHILLILKYSYDNLNDKhVRSCFQ 410  

                   hIACfFN.gekvdy..VkalLadsnnLDVrqG...........LkvLadK
                   + A    ++++ +y+ +  ++ +  + D ++G+++  +++ + L +L+  
  gi|7443911   411 YCALYPEdYSIKKYrlIDYWICEG-FIDGNIGkeravnqgyeiLGTLVRA 459  

                   SLIhisplgnedkvdgtieMHnLLqqLG............ReAIVrk...
                   +L + +  g++   +  ++MH+  ++++  + ++ +++++R  IV+++++
  gi|7443911   460 CLLSEE--GKN---KLEVKMHDVVREMAlwtlsdlgknkeRC-IVQAgsg 503  

                   .......QsidhdePgKRqFLvD..aeeIcdVLtdnTGtgtrsVlGIslD
                    ++ ++ +  +      R  L++++ eeI+   +    t         l 
  gi|7443911   504 lrkvpkvEDWG---AVRRLSLMNngIEEISGSPECPELTT--------LF 542  

                   tseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   + e++  ++Is + F+ Mr L  L   ++ + d  +   
  gi|7443911   543 LQENKSLVHISGEFFRHMRKLVVLDLSENHQLDGLP    578  

gi|7489236|pir||T07774: domain 1 of 1, from 1 to 150: score -193.3, E = 0.011
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                                   RA
  gi|7489236     1    ---------------------------------------------RA 2    

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    f+ LS      +F+ s+F+e ++              +++   +s    
  gi|7489236     3 IFDTLS-----YQFEASCFIEDIK-------------ENKCGM-HS---- 29   

                   LhLQeqfLSkILnqkDikIhd.....HLGvieERLkdqKVLIiLDDVDdl
                     LQ+ +LS++L+ kDi ++++++++H   i  RL  +KVL++LDD+D+ 
  gi|7489236    30 --LQNILLSELLREKDIYVNNkedgkHM--IARRLPFKKVLVVLDDIDHR 75   

                   eQLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeAL
                   + Ld LA+ t+WFG GSRII TT Dk+L    ++   +YeV+   + +A 
  gi|7489236    76 DHLDYLAGNTSWFGDGSRIIATTRDKHLIGKNDV---VYEVSTLVDCHAI 122  

                   qIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskee
                   + F ++AF++  P + Fe+L                              
  gi|7489236   123 KLFNQYAFKEEVPDERFEKL------------------------------ 142  

                   WedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgek
                                 sL                                  
  gi|7489236   143 --------------SL---------------------------------- 144  

                   vdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLL
                                                                     
  gi|7489236     - -------------------------------------------------- -    

                   qqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIs
                        e +                                          
  gi|7489236   145 -----E-V------------------------------------------ 146  

                   lDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                              ++            
  gi|7489236   147 ---------------------------VDYA-------    150  

gi|7489352|pir||T30558: domain 1 of 1, from 165 to 548: score -193.3, E = 0.011
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                      k L  L+  +   ++  wG  G+GKTT  + 
  gi|7489352   165    ----------------KALEALEPVQKSHIIALWGMGGVGKTTMMKK 195  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSg..etrpaglDeYsyG
                   L           +   ++++  + g          ++  +   + +Y   
  gi|7489352   196 LKEVVE-----QKKTCNIIVQVVIG-------EKTnpIAIQQAVADY--- 230  

                   mKLhLQeqfLSkILnqkDikIhdHLGvieERLk....dqKVLIiLDDV..
                   +   L e       n k  + +  L   + R   +++  K L+iLDDV +
  gi|7489352   231 LSIELKE-------NTKEARAD-KL---RKRFEadggKNKFLVILDDVwq 269  

                   ....DdleQLdALAketqWFGpGSRIIVTTeDkqL..LkaHgInhtIYeV
                     + +d+  L  L ++    G    +  T  D +  +L+  + n  I   
  gi|7489352   270 ffdlEDIG-LSPLPNK----GVNFKVLLTSRDSHVctLMGAEANS-ILNI 313  

                   gfPSkeeALqIFCrsAFgQnsPpdG....FeeLeAreVtkLaGnLPLGLr
                   +   + e    F + A  +n   d+ ++ F  + A  ++ ++  LP + +
  gi|7489352   314 KVLKDVEGKSLFRQFA--KNAGDDDldpaFIGI-ADSIASRCQGLPIAIK 360  

                   VlGSsLRGkskeeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhek.Dq
                       sL+G+sk  W  +L RL++   ++  + + +v ++sYD L ++  +
  gi|7489352   361 TIALSLKGRSKSAWDVALSRLEN-HKIGSEEVVREVFKISYDNLQDEvTK 409  

                   aLFLhIACfFNgekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgn
                   ++FL+ A f   ++   +++l           GLk   +   I+  +++ 
  gi|7489352   410 SIFLLCALFPEDFD-IPIEELVRYG------WGLKLFIEAKTIREARNRL 452  

                   e..............dkvdgtieMHnLLq....qLGReAIVrkQsidhde
                   ++ +++ ++++   + +  g+++MH+  ++   ++  e  V + si    
  gi|7489352   453 NncterlretnllfgSHDFGCVKMHDVVRdfvlHMFSE--VKHASI---- 496  

                   PgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslD...tseieeelnIsek
                          v+    ++  + n  +   s   Isl  +++s+  + +n    
  gi|7489352   497 -------VNHGNMSEWPEKNDTSN--SCKRISLTckgMSKFPKDINY--- 534  

                   AFegMrNLqFLriykksfrddgk<-*
                        +NL+ L+        d+    
  gi|7489352   535 -----PNLLILKLMHG----DKS    548  

gi|8547237|gb|AAF76312.1|AF220603_4: domain 1 of 1, from 1090 to 1489: score -193.3, E = 0.011
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      r  +++ G  + + ++k  L   s  e   + I G +G GKTT A+ 
  gi|8547237  1090    RANEEMEGFQDTIDELKDKLLGGS-PELDVISIVGMPGLGKTTLAKK 1135 

                   Lfs..qLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyG
                    ++++        s+F  +a                  t       Ys  
  gi|8547237  1136 IYNdpEVT-----SRFDVHAQCV--------------VTQL-----YS-- 1159 

                   mKLhLQeqfLSkILn..........qkDikIhdHLGvieERLkdqKVLIi
                       ++e +L  ILn+  +++++++++D +I d L   +  L  ++ LI 
  gi|8547237  1160 ----WRELLL-TILNdvlepsdrneKEDGEIADEL---RRFLLTKRFLIL 1201 

                   LDDVDdleQLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgf
                   +DDV d ++ d L    +   + SRII TT      +    +    +  +
  gi|8547237  1202 IDDVWDYKVWDNLCMCFSDVSNRSRIILTTRLNDVAEYVKCESDPHHLRL 1251 

                   PSkeeALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsL
                     ++e  + +    F   s p   e+   +e+ k +  LPL    +   L
  gi|8547237  1252 FRDDESWTLLQKEVFQGESCPPELEDV-GFEISKSCRGLPLSVVLVAGVL 1300 

                   R..GkskeeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLh
                   +++ k+ + W+ +   L +   +sL + I ++  +sY  L +  +  FL+
  gi|8547237  1301 KqkKKTLDSWKVVEQSLSSQRIGSLEESI-SIIGFSYKNLPHYLKPCFLY 1349 

                   IACfFNgekvdyV....kalLadsnnLDVrqG..........LkvLadKS
                      f  g++  +V++ +k + a+  ++  ++ ++++++ ++ L  L  + 
  gi|8547237  1350 FGGFLQGKD-IHVskmtKLWVAEG-FVQANNEkgqedtaqgfLDDLIGRN 1397 

                   LIhisplgnedkvdgtieMHnLLqqLGReAIVrkQsidhdePgKRqFLvD
                   L+   +++ + k  +t++ H+LL ++  e    kQ+ d        FL  
  gi|8547237  1398 LVMAMEKRPNAK-VKTCRIHDLLHKFCME--KAKQE-D--------FLLQ 1435 

                   aeeIcdVLtdnTGtgtrsVlGIslDtseieeelnIsekAFegMrNLqFLr
                    +    V+ +            +l ++  ++e++    +    r L+F  
  gi|8547237  1436 INSGEGVFPERLEEY-------RLFVHSYQDEIDLWRPSRSNVRSLLFNA 1478 

                   iykksfrddgk<-*
                   i+ +   +      
  gi|8547237  1479 IDPDNLLWPRD    1489 

gi|5702196|gb|AAD47197.1|AF107293_1: domain 1 of 1, from 189 to 562: score -194.1, E = 0.012
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrM.....VGIwGPaGIGKT
                      rD d +V         + LL      e+   + ++  I G  G GK+
  gi|5702196   189    RDRDRIV---------DFLLGKTTTAEASSakysgLAIVGLGGMGKS 226  

                   TIARALfs..qLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglD
                   T A   ++++++      + F  +  +  +r                 lD
  gi|5702196   227 TLAQYVYNdkRIE-----ECFDIRMWVCISR----------------KLD 255  

                   eYsyGmKLhLQeqfLSkIL..nqkDi..kIhdHLGvieERLkd.....qK
                    +        + +   +I+++ +k+  ++++ +L +++  L+d  +++qK
  gi|5702196   256 VHR-------HTR---EIIesAKKGEcpRVD-NLDTLQCKLRDilqesQK 294  

                   VLIiLDDV......Ddle...QLdALAketqWFGpGSRIIVTTeDkqLLk
                    L++LDDV  +++++  e + +L  L+ +     +GS + VT   k L  
  gi|5702196   295 FLLVLDDVwfekshNETEwelFLAPLVSKQ----SGSKVLVTSRSKTLPA 340  

                   a......HgInhtIYeVgfPSkeeALqIFCrsAF.....gQnsPpdGFee
                   a   +++H I ++    +   + e L  F  +AF++ + +    +   e+
  gi|5702196   341 AicceqeHVIHLK--NMD---DTEFLALFKHHAFsgaeiKDQVLRTKLED 385  

                   LeAreVtkLaGnLPLGLrVlGSsLRG.kskeeWedmLpRLrtsfgnsLDg
                     A+e++k+ G  PL+ +VlGS L ++k+  eW+ +   L+ +    L  
  gi|5702196   386 T-AVEIAKRLGQCPLAAKVLGSRLCRkKDIAEWKAA---LKIG---DL-S 427  

                   kIekvLrvsYDgLhekDqaLFLhIACf...FNgekvdyVkalLadsnnLD
                   +    L  sY++L+ + q  FL+   f+++ ++e  ++V+ + a+     
  gi|5702196   428 DPFTSLLWSYEKLDPRLQRCFLYCSLFpkgHRYESNELVHLWVAEG---- 473  

                   VrqGLkvLadKSLIhisplgne............d.kv..dgtieMHnLL
                     +G ++L  + L  + +  ++ ++  + +  + + ++  d + +MH+ L
  gi|5702196   474 -FVGSCNLSRRTLEEVGM--DYfndmvsvsffqlVfHIycDSYYVMHDIL 520  

                   qqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIs
                     ++ e      s              ++e c  L+d+  t+        
  gi|5702196   521 HDFA-E------SL-------------SREDCFRLEDDNVTE-------- 542  

                   lDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                        i              +  + L+i+ +s +++++   
  gi|5702196   543 -----IP-------------CTVRHLSIHVHSMQKHKQ    562  

gi|2443884|gb|AAB71477.1|: domain 1 of 1, from 148 to 547: score -194.4, E = 0.012
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      r     +G E+ lek     +L   d+V + G  G  G+GKTT  + 
  gi|2443884   148    RPTQPTIGQEDMLEKAWN--RLME-DGVGIMGLHGMGGVGKTTLFKK 191  

                   LfsqLSerhFq.ssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGm
                    ++++ e    +  F   + +  ++g +           ++ l e     
  gi|2443884   192 IHNKFAE---IgGTFDIVIWIVVSKGVM-----------ISKLQED-IAE 226  

                   KLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLd
                   KLhL        L ++  + +     i   Lk ++  + LDD+   + L+
  gi|2443884   227 KLHLCDD-----LWKNKNESD-KATDIHRVLKGKRFVLMLDDIWEKVDLE 270  

                   AL.......AketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSke
                   A++ + +++++          +  TT  ++     g      +V     e
  gi|2443884   271 AIgipypseVN-------KCKVAFTTRSREVCGEMGDHKP-MQVNCLEPE 312  

                   eALqIFCrsAFgQnsPpdG..FeeLeAreVtkLaGnLPLGLrVlGSsLRG
                   +A + F     g n+   ++   eL AreV+  +  LPL+L+V G  +  
  gi|2443884   313 DAWELF-KNKVGDNTLSSDpvIVEL-AREVAQKCRGLPLALNVIGETMSS 360  

                   ksk.eeWedmLpRLrtsfg..nsLDgkIekvLrvsYDgLhek.DqaLFLh
                   k+  +eWe +++ + ts  +      kI  +L+ sYD+L +++ ++ FL+
  gi|2443884   361 KTMvQEWEHAIHVFNTSAAefSDMQNKILPILKYSYDSLGDEhIKSCFLY 410  

                   IACfFN.gek..vdyVkalLadsnnLDVrqGLkvLadKSLIhisplgned
                    A f  +ge+ + +++  ++ +  +    q  k   +K      +l++++
  gi|2443884   411 CALFPEdGEIynEKLIDYWICEG-FIGEDQVIKRARNKGYAMLGTLTRAN 459  

                   ...kv.dgtieMHnLLqqLGReAIVrk..........QsidhdePgKRqF
                     +kv+  +++MH+  ++++   I    ++++++   Q  +         
  gi|2443884   460 lltKVgTYYCVMHDVVREMALW-IASDfgkqkenfvvQA-G--------- 498  

                   LvDaeeIcdVLtdnTGtgtrsVlGIslDtseieeelnIsekAFegMrNLq
                    v  +eI  V   + G   r+++ ++ D+ ei +e   se         +
  gi|2443884   499 -VGLHEIPKV--KDWGAV-RKMSLMDNDIEEITCESKCSELT------TL 538  

                   FLriykksfrddgk<-*
                   FL  +k      ++   
  gi|2443884   539 FLQSNK-----LKN    547  

gi|7489454|pir||T00020: domain 1 of 1, from 299 to 673: score -194.5, E = 0.012
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                             G  a +e +k+L   +  ++     I G  GIGKTT A  
  gi|7489454   299    -------GRAAEMETIKQLIMSNRSNGITVLPIVGNGGIGKTTLAQL 338  

                   LfsqLSerhFq.ssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGm
                       L      +s+F  ++ ++ ++                 +D     +
  gi|7489454   339 VCKDLV----IkSQFNVKIWVY-VS---------------DKFDV----V 364  

                   KLhLQeqfLSkILnqkDikIhdHLGvieERL....kdqKVLIiLDDV...
                   K    +q L  + nq +  I+ +L ++++ L+++ k +K LI+LDDV + 
  gi|7489454   365 KIT--RQILDHVSNQSHEGIS-NLDTLQQDLeeqmKSKKFLIVLDDVwei 411  

                   ..DdleQLdA......LAketqWFGpGSRIIVTTeDkqLLkaHg.InhtI
                   ++Dd + L A+ ++++ ++ +q    G  II TT  + + k+ g++   I
  gi|7489454   412 rtDDWKKLLAplrpndQVNSSQEEATGNMIILTTRIQSIAKSLGtVQS-I 460  

                   YeVgfPSkeeALq......IFCrsAFg..QnsPpdGFeeLeAreVt.kLa
                          k eAL++++  + F  +AFg+++     G + L  ++++++L 
  gi|7489454   461 -------KLEALKdddiwsLFKVHAFGndKHDSSPGLQVL-GKQIAsELK 502  

                   GnLPLGLrVlGSsLRG..........kskeeWedmLpRLrtsfgnsLDgk
                   Gn PL+ + +GS L  + + ++ ++  + eeW+     L+       +g 
  gi|7489454   503 GN-PLAAKTVGSLLGTnltidhwdsiIKSEEWKS----LQQ-----AYG- 541  

                   IekvLrvsYDgLhe...................kDqaLFLhIACfFNgek
                   I+  L+ sYD L+++ ++  +  +  +++ + +k q +   IA  F +e 
  gi|7489454   542 IMQALKLSYDHLSNplqqcvsycslfpkgysfsKAQLIQIWIAQGFVEES 591  

                   vdyVkalLadsnnLDVrqGLkvLadKSLIhisplgned..kv.dgtieMH
                    ++++     +       G+k La+  L++   l++ ++++ + ++ +MH
  gi|7489454   592 SEKLE----QK-------GWKYLAE--LVNSGFLQQVEstRFsSEYFVMH 628  

                   nLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVl
                   +L   L+ + +   Q                       +++T +g     
  gi|7489454   629 DLMHDLAQK-V--SQT----------------------EYATIDG----- 648  

                   GIslDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                         se   el  s          + L+i ++s  +++k   
  gi|7489454   649 ------SECT-ELAPS---------IRHLSIVTDSAYRKEK    673  

gi|8118138|gb|AAF72909.1|: domain 1 of 1, from 1 to 157: score -194.6, E = 0.013
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                           L                         
  gi|8118138     1    ---------------------LATP---------------------- 4    

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L+ ++S     ++F   +F++ ++++y                +Y+    
  gi|8118138     5 LYARIS-----NQFDACCFIDDVSKIY---------------GDYG---P 31   

                   LhLQeqfLSkILnqkDikIhdHL....GvieERLkdqKVLIiLDDVDdle
                      Q+q+LS+ L+  +++I+ +L   +  i++ L++ K L++LD VD++e
  gi|8118138    32 IGVQKQLLSQTLKEGNLQIC-NLymasNMIRNTLCQIKSLVVLDNVDQVE 80   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                    Ld LA   +W G GSRIIV+  D ++L+ Hg++  +Y+V +     A+q
  gi|8118138    81 HLDKLAMTREWLGTGSRIIVISRDDHILREHGVDE-VYKVRLLDHNNAFQ 129  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    FCr AF+ n    ++ +L                               
  gi|8118138   130 LFCRKAFKSNDIMSDYLDL------------------------------- 148  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                           t                                         
  gi|8118138   149 --------T----------------------------------------- 149  

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                                                                     
  gi|8118138     - -------------------------------------------------- -    

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                                                 +dVLt++             
  gi|8118138   150 ------------------------------YDVLTYAN------------ 157  

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                           
  gi|8118138     - -------------------------------------    -    

gi|14348613|gb|AAK61315.1|AF306499_1: domain 1 of 1, from 183 to 601: score -195.1, E = 0.013
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      rD d  + i     +       d+ ++  +  I G  G GKTT A  
  gi|1434861   183    RDADKDIIINWLTSET------DNPNQPSILSIVGMGGLGKTTLAQH 223  

                   Lfs..qLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyG
                    +s++++       +F  +a +  ++                   ++   
  gi|1434861   224 VYSdpKIED----AKFDIKAWVC-VS-------------------DHF-- 247  

                   mKLhLQeqfLSkILnqk....DikIhdHLGvieERLkdqKVLIiLDDVDd
                     L   +  L  I+++ +++++++   H   ++E L  ++ L++LDDV +
  gi|1434861   248 HVLTVTRTILEAITDKTndsgNLEMV-HK-KLKEKLLGKRFLLVLDDVWN 295  

                   leQLdALAketqW........FG.pGSRIIVTTe..........DkqLLk
                             ++W+  +++ ++G pGSRI VTT +++  ++ ++  +LLk
  gi|1434861   296 ER-------PAEWeavrtplsYGaPGSRILVTTRsekvassmrsEVHLLK 338  

                   aHgInhtIYeVgfPSkeeALqIFCrsAFgQnsPpdGFeeLeAreVtkLaG
                   + g +    +V    + +AL+       g     d  ++   r++++ + 
  gi|1434861   339 QLGEDE-CWKVF---ENHALKD------GDLELNDELMKV-GRRIVEKCK 377  

                   nLPLGLrVlGSsLR.GkskeeWedmLpR....LrtsfgnsLDgkIekvLr
                    LPL+L+  G  L +  s  +W+++L  +  +L +      + +I   L 
  gi|1434861   378 GLPLALKTIGCLLStKSSISDWKNILESdiwkLPK-----EHSEIIPALF 422  

                   vsYDgLhekDqaLFLhIACfFNgekvdyVkalLadsnnLDVrqGLkvLad
                    sY  L ++ +  F + A +F +   + Vk+ L           +   a+
  gi|1434861   423 LSYRHLPSHLKRCFAYCA-LFPKDY-EFVKEELI----------FLWMAQ 460  

                   KSLIhisplgne....................d.kvdgtieMHnLLqqLG
                     L +  p + +++++ +++  ++  ++   +++ + g+ +MH+LL  L+
  gi|1434861   461 NFLLS--PQHIRdpeeigeeyfndllsrcffnQsSIVGHFVMHDLLNDLA 508  

                   ReAIVrk...................QsidhdePgKRqFL.vDaeeIcdV
                   +   V+++   + + ++++  ++++ +          +FL+v++ +  + 
  gi|1434861   509 KY--VCAdfcfrlkfdnekcmpkttcHFS-------FEFLdVESFDGFES 549  

                   LtdnTGtgtrsVlGIslDtseieeelnIs.ekAFegMrNLqFLriykksf
                   Lt+++  +  s+l Is +t++ +  + Is  + F ++   + L+++ +++
  gi|1434861   550 LTNAKRLR--SFLPIS-ETWGASWHFKISiHDLFSKIKFIRVLSFHGCLD 596  

                   rddgk<-*
                    ++ +   
  gi|1434861   597 LREVP    601  

gi|4092774|gb|AAC99466.1|: domain 1 of 1, from 174 to 591: score -195.7, E = 0.014
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         + lVGi+a   k+   L L  + ++  V + G  G GKTT    
  gi|4092774   174    ---NSLVGIDAAKGKLIGWL-LSPEPQRIVVSVVGMGGSGKTT---- 212  

                   LfsqLSerhFq.ssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGm
                   L   +++++  ++ F   a ++ +++sy  e+++       ++ e +  +
  gi|4092774   213 LSANIFKSQTVrKHFASYAWVT-ISKSYVIEDVFR-----TMIKEFYKEA 256  

                   KLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLd
                     +   ++ S   +     ++  L    E L+ ++ +++LDDV +  +  
  gi|4092774   257 ETQIPGELYSLTYREL---VE-KL---VEYLHSKRYFVVLDDVWNTSLWR 299  

                   ....ALAketqWFGpGSRIIVTTeDkqLL........kaHgInhtIYeVg
                   + + AL + +    +GSR+++TT      + + +++++ H+I++      
  gi|4092774   300 einiALPDGI----SGSRVVITTRSNNVAsfsygsgsRKHEIELL----- 340  

                   fPSkeeALqIFCrsAFg...QnsPpdGFeeLeAreVtkLaGnLPLGLrVl
                      ++eA   FC  AF ++ +   +   e + Ar+  +++  LPL+   l
  gi|4092774   341 --NEDEAWVLFCNKAFSgslEECRRRNLELI-ARKLLERCQGLPLAIASL 387  

                   GSsLR.GkskeeWedmLpRLrtsfgnsLDgkIe.....kvLrvsYDgLhe
                   GS + + + + eW+ +   L       L+ + e +  +++L  s+ +L  
  gi|4092774   388 GSMMStKRLESEWKQVYNSLNW----ELNNNLElkvvrSILSLSFSDLPY 433  

                   kDqaLFLhIACf...FN.gekvdyVkalLadsnnLDVrqG..........
                     +  FL+   f+ + + ++k  +V  + a   ++    G + ++  ++ 
  gi|4092774   434 PLKRCFLYCCMFpvnYRmKRK-RLVRMWMAQR-FVEPIRGvkaeevadgy 481  

                   LkvLadKSLIhisplgnedkvdgtieMHnLLqqLGReAIVrk........
                   L+ L+++   ++  ++   +  +  +MH+  ++ +   I  +++  + ++
  gi|4092774   482 LNELVYRNMLQVILWNPFGR-PKVFKMHDVIREIALS-ISKAerfcdvng 529  

                   ......QsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtse
                   ++++++ ++  ++ g R+  +  e        +T  +           ++
  gi|4092774   530 ddddddAET-AEDHGTRHLCIQKE-----MRSGTVRR-----------TN 562  

                   ieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   +   l+  + + e  + L+ Lr      + +g    
  gi|4092774   563 LHTLLVCTKHSIELPPSLKLLRAL----DLEGS    591  

gi|12321052|gb|AAG50648.1|AC082643_12: domain 1 of 1, from 156 to 523: score -195.7, E = 0.014
                   *->rDFd.dlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIAR
                      rD ++d+VG+Ea  +k+   L  +  d+  +V   G  G GKTT AR
  gi|1232105   156    RDSEnDFVGMEANVKKLVGYL-VEK-DDYQIVSLTGMGGLGKTTLAR 200  

                   ALfs..qLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsy
                     f+++        ++F   a ++ + +          +tr+        
  gi|1232105   201 QVFNhdVVK-----DRFDGFAWVSVSQE----------FTRI-----SV- 229  

                   GmKLhLQeqfLS.....kILnqkDikIhdHLGvieERLkdqKVLIiLDDV
                    ++  LQ+ + S++++++I n+k    hd+L      L   K LI+LDD+
  gi|1232105   230 -WQTILQN-LTSkerkdEIQNMKEADLHDDL---FRLLESSKTLIVLDDI 274  

                   ...DdleQLdAL..AketqWFGpGSRIIVTTeDkqLLkaHg..InhtIYe
                    +++d ++ + + + k   W             k LL +  ++I      
  gi|1232105   275 wkeEDWDLIKPIfpPK-KGW-------------KVLLTSRTesIAMR--- 307  

                   VgfPSkeeALqIFCr...................sAFgQnsPpdGFeeLe
                    +  +++  ++  C++ +++ +  ++   +++++s F+     +  e+  
  gi|1232105   308 GD--TTYISFKPKCLsipdswtlfqsiamprkdtSEFK---VDEEMENM- 351  

                   AreVtkLaGnLPLGLrVlGSsLR.GkskeeWedmLpRL......rtsfgn
                    ++ +k++G L L+ +VlG  L    + ++W+++   ++++  +rts   
  gi|1232105   352 GKKMIKHCGGLSLAVKVLGGLLAaKYTLHDWKRLSENIgshiveRTS--- 398  

                   sLDgkIekvLrvsYDgLhekDqaLFLhIACfFN..gekvdyVkalLadsn
                   + +  I+ vL vs+++L +  +  FL+ A f  +++ +v++++ + a+ +
  gi|1232105   399 GNNSSIDHVLSVSFEELPNYLKHCFLYLAHFPEdhEIDVEKLHYYWAAEG 448  

                   nLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGReAIVrk.
                                   I+ ++  +                   e  +r +
  gi|1232105   449 ----------------ISERRRYDG------------------E-TIRDt 463  

                   .QsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslD..tseiee
                   + s   +e   R   +  +   dV t    t        +l++ ++ei  
  gi|1232105   464 gDSY-IEELVRRNMVISER---DVMTSRFETC-------RLHdmMREIC- 501  

                   elnIsekAFegMrNLqFLriykksfrddgk<-*
                    +   e+         FL i  + +  +++   
  gi|1232105   502 LFKAKEE--------NFLQIVSNHSPTSNP    523  

gi|15088546|gb|AAK84082.1|AF326781_3: domain 1 of 1, from 389 to 762: score -195.9, E = 0.015
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      + F  l+G E    ++ +L       +   + ++G  G GKTT  R 
  gi|1508854   389    KEFQ-LIGREKEKSEIIQLVTNGDGRQFEVISVCGMGGLGKTTVVRD 434  

                   Lf.sqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGm
                    ++sq        +F+  a ++ ++             rp + De    +
  gi|1508854   435 VYqSQELR----GKFEKCACVT-IM-------------RPFNCDE----L 462  

                   KLhLQeqfLSkILnqkDi..kIhdHLGvieERLkdqKVLIiLDDVDdleQ
                     +L  qf     + +D+ ++++ HL         +K LI+LDD+     
  gi|1508854   463 LKNLAGQF-----GYEDVadMVR-HL-------EGKKCLIVLDDLSSTRE 499  

                   LdAL.....AketqWFGpGSRIIVTTeDkqLLkaHgInht.IYeVgfPSk
                    dA+ ++ +A et+     SRIIVTT    + k    + ++IY+      
  gi|1508854   500 WDAIiphftALETS-----SRIIVTTRVEDIGKHCSKKRKnIYKLQGLEL 544  

                   eeALqIFCrsAFgQns.PpdGFeeL..eAreVtkLaGnLPLGLrVlGSsL
                    +A   F +  F ++ +  + + eL ++++ + k +  LPL+    G  L
  gi|1508854   545 NDAHDLFIQKVFDKTMdLDEQYPELveQTNMILKKCKGLPLAIVTIGGFL 594  

                   RG..kskeeWed...........mLpRLrtsfgnsLDgkIekvLrvsYDg
                     ++k+  eW++ +++ +  + +m p+L+          I  vL  sYDg
  gi|1508854   595 ANqpKTALEWKKlnehisaaelqMNPELEA---------IITVLNKSYDG 635  

                   LhekDqaLFLhIACfFN.gekvdyVkalLadsnnLDVrqGL.kvLadKS.
                   L  + ++ FL+  +f  ++ +  ++k lL       +  G + v  +KS+
  gi|1508854   636 LPYHLKSCFLYLSIFPEdYNI--KLKRLLRRW----IAEGYpGVVRNKSt 679  

                   ..........LIhisplgne.....d.kvdgtieMHnLLqqLGReAIVrk
                   ++  ++   +LI+ s+l   +++  d+k  g +  H+L ++ G       
  gi|1508854   680 eevaesyfmdLISRSMLLPSqrsicDgKRIGSCQVHDLIREIGIS----- 724  

                   QsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtseieeeln
                   +s            ++ +    VL  + G +        l+t ++     
  gi|1508854   725 KS------------MEGN---LVLRLEEGCS--------LNTQGTA---- 747  

                   IsekAFegMrNLqFLriykksfrddgk<-*
                               + L i  +++rd+     
  gi|1508854   748 ------------RHLAISSNWERDQSA    762  

gi|13937084|gb|AAK50041.1|AF363796_1: domain 1 of 1, from 1 to 170: score -196.4, E = 0.016
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                ++           GKTTIA+ 
  gi|1393708     1    -------------------------GGM-----------GKTTIAKS 11   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                     + +      + F  +    n+r+     + g+g     g+ +      
  gi|1393708    12 ICNEIR-----HEFKYKSYLANIRE-----AWGGG----RGPVD------ 41   

                   LhLQeqfLSkILnqkDikIhdHL....GvieERLkdqKVLIiLDDVDdle
                     LQeq+LS IL+ k+ k+h   + ++G i+E+L+ +KVL+ LDDV  +e
  gi|1393708    42 --LQEQLLSDILKTKN-KVH-STdwgkGKIKEMLCTKKVLVLLDDVSSVE 87   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   QL  L +     G GS II+TT +  LL+  g+++ +  V+   + e L+
  gi|1393708    88 QLNDLCGNRDAIGEGSVIIITTRNVRLLREIGVDC-VHRVEKMNELESLE 136  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    F  +A ++  P  +  eL ++eV++ +G LPL L               
  gi|1393708   137 LFSWHALRRADPCRDLFEL-SQEVVTYCGGLPLTL--------------- 170  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                                                                     
  gi|1393708     - -------------------------------------------------- -    

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                                                                     
  gi|1393708     - -------------------------------------------------- -    

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                                                                     
  gi|1393708     - -------------------------------------------------- -    

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                           
  gi|1393708     - -------------------------------------    -    

gi|5817345|gb|AAD52716.1|AF123700_1: domain 1 of 1, from 1 to 159: score -197.4, E = 0.017
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                                  A+A
  gi|5817345     1    ------------------------T-------------------AKA 4    

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++q++     ++F+++ F+en+r+              ++  + +    
  gi|5817345     5 IYNQIH-----RKFEDRSFIENIRE--------------VCEKDND--GI 33   

                   LhLQeqfLSkILnqkDikIhdHL....GvieERLkdqKVLIiLDDVDdle
                    +LQeq+LS +L+ k  kIh   ++++  ie RL  +KVL++LDDV   e
  gi|5817345    34 IRLQEQLLSDVLKVKVKKIH-SItsgtTMIEKRLVRKKVLVVLDDVSTFE 82   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInht..IYeVgfPSkeeA
                   Q +AL +  +WF +GS  IVTT D +LLk   + h  ++ e +   +++ 
  gi|5817345    83 QIKALCGNRKWFASGSVLIVTTRDVHLLKLLKVAHVctMKEMD---EDDS 129  

                   LqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkske
                   L+ FC +AF++  P+  F +L +r V+  +G                   
  gi|5817345   130 LELFCWHAFREPIPRKYFGKL-SRNVVAYCG------------------- 159  

                   eWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNge
                                                                     
  gi|5817345     - -------------------------------------------------- -    

                   kvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnL
                                                                     
  gi|5817345     - -------------------------------------------------- -    

                   LqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGI
                                                                     
  gi|5817345     - -------------------------------------------------- -    

                   slDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                             
  gi|5817345     - ---------------------------------------    -    

gi|8809609|dbj|BAA97160.1|: domain 1 of 1, from 163 to 534: score -197.4, E = 0.018
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                          +L     V   GI+G  G+GKTT    
  gi|8809609   163    --------------------RLMD-INVGTLGIYGRGGVGKTTLLTK 188  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L ++L      + F l +F+  +      ee+ S   +  ++  +   + 
  gi|8809609   189 LRNKLLV----DAFGLVIFVV-VG----FEEVES---IQDEIGKR---LG 223  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVD...dleQ
                   L+++++        k  k      ++   Lk ++  + LD++ ++ dle 
  gi|8809609   224 LQWRRE-------TKERKAA-EILAV---LKEKRFVLLLDGIQrelDLE- 261  

                   LdALAketqWFG.......pGSRIIVTTeDkqLLkaHg.InhtIYeVgfP
                         e+   G + +++++G  I+ TT+  +       ++ +  e    
  gi|8809609   262 ------EI---GvpfpsrdNGCKIVFTTQSLEACDESKwVDAK-VEITCL 301  

                   SkeeALqIFCrsAFgQnsPp..dGFeeLeAreVtkLaGnLPLGLrVlGSs
                   S eeA   F +   g+n+ +++ +  +L Ar V+  +  LPL+L+  G +
  gi|8809609   302 SPEEAWDLF-QETVGENTLRshQDIPKL-ARVVASTCRGLPLALNLIGEA 349  

                   LRG.kskeeWedmLpRLrts...fgnsLDgkIekvLrvsYDgLhek.Dqa
                   + G+++  eW  +++ L +s+ +f +  Dg    +L+  YD  +++    
  gi|8809609   350 MSGkRTVREWRYTIHVLASStaeFPDMEDGT-LPILKSIYDNMSDEiIRL 398  

                   LFLhIACf...FN.gekvdyVkalLadsnnLDVr.......qGLkvLadK
                    FL+ A f+++   g++ d+V  ++ +   L  +++++ + qG ++ +d 
  gi|8809609   399 CFLYCALFpenLDiGKE-DLVNYWICEG-ILAKEdreeaeiQGYEIICDL 446  

                   SLIhisplgnedkvdgtieMHnLLqqLGReAIVrkQsidhdePgKRqFLv
                      +  +++ +     +++MH + ++++   I  ++ +           v
  gi|8809609   447 VRMRLLMESGN---GNCVKMHGMVREMALW-IASEHFV----------VV 482  

                   DaeeIcdVLtdnTGtgtrsVlGIslDtseieeelnIsekAFegMrNLqFL
                     e I+  L+ n    +r +  +s   + i+   nIs++     + L  L
  gi|8809609   483 GGERIHQMLNVND---WRMIRRMSVTSTQIQ---NISDSP--QCSELTTL 524  

                   riykksfrddgk<-*
                    + ++  r+ +    
  gi|8809609   525 VFRRN--RHLKW    534  

gi|7489234|pir||T07766: domain 1 of 1, from 2 to 149: score -198.0, E = 0.019
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                            ++                       
  gi|7489234     2    ----------------------KY----------------------- 3    

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    f++ S     ++Fq s+F  n+r                ++  ++    
  gi|7489234     4 -FDKVS-----HQFQRSCFLANVR---------------EESKKHG---L 29   

                   LhLQeqfLSkILnqkDikIhdHL....GvieERLkdqKVLIiLDDVDdle
                    hLQ+ +LSk+L+ k + I   + ++   i+ RL++ KVLI+ DDVDd +
  gi|7489234    30 MHLQKTLLSKLLKEKSMNIA-SFyegaDMIKRRLCHWKVLIVFDDVDDED 78   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   QL+ L++   WFG GS II TT ++ LL++H  +   Y V    k eA +
  gi|7489234    79 QLKYLVGNHDWFGGGSIIITTTRNQDLLRSH--DQ-LYSVPVLAKAEAIE 125  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    F  +AF + +P   F +L                               
  gi|7489234   126 VFSWHAFQKPTPDKEFLKL------------------------------- 144  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                           +                                         
  gi|7489234   145 --------S----------------------------------------- 145  

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                           +s                                        
  gi|7489234   146 --------KS---------------------------------------- 147  

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                         +                                           
  gi|7489234   148 ------V------------------------------------------- 148  

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                           
  gi|7489234   149 ------------------------------------V    149  

gi|14279468|gb|AAK58606.1|AF271293_1: domain 1 of 1, from 168 to 581: score -198.1, E = 0.019
                   *->rDFddlVG..iEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIA
                          +lVG++i    +k+ sL   + +d +    I G  GIGKTT A
  gi|1427946   168    ----NLVGkeIVHACRKLVSLVVAHKEDKAYKLAIVGTGGIGKTTLA 210  

                   RALfs..qLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYs
                      f++++L        F  +a +  ++                   +Y 
  gi|1427946   211 QKVFNdqKLK-----GTFNKHAWIC-VS------------------QDY- 235  

                   yGmKLhLQeqfLSkILnqkDikIhdHLGvieERL....kdqKVLIiLDDV
                        +  +q+L  +  q + + +   G ++  L+   kd+  +++LDD+
  gi|1427946   236 --TPVSVLKQLLRTMEVQ-HAQEE-SAGELQSKLelaiKDKSFFLVLDDL 281  

                   DdleQLdALAketqWFGpGSRIIVTTeDkqLL.kaHgInhtIYeVgfPSk
                    ++++   L   t      S II +T  + +  +  g++     V++ S 
  gi|1427946   282 WHSDVWTNLLR-TPLHAATSGIILITTRQDIVaREIGVEE-AHRVDLMSP 329  

                   eeALqIFCrsAFgQnsPp.dGFeeLeAreVtkLaGnLPLGLrVlGSsLR.
                       + +  s   Q+        ++   e++  +G LPL+ +V    L +
  gi|1427946   330 AVGWELLWKSMNIQDEREvQNLRDI-GIEIVQKCGGLPLAIKVTARVLAs 378  

                   .GkskeeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIA
                   + k+++eW+++L     s    L  +I   L  sYD+L ++ +       
  gi|1427946   379 kDKTENEWKRILANNVWS-MAKLPKEISGALYLSYDDLPQHLKQ------ 421  

                   CfFNgek.........vdyVkalLadsnnLDV..rqGLkvLadKS...LI
                   Cf N+   +++ + ++ +++  + a+  ++ V++ q L+  a+    +LI
  gi|1427946   422 CFLNCIVfpkdwtlkrNELIMMWVAEG-FVEVhkDQLLEDTAEEYyyeLI 470  

                   hisplgned.kv.dgtieMHnLLqqLGReAIVrk............Qsid
                   + + l+  d+  ++ +++MH+LL+qL+     r++   ++ ++     i 
  gi|1427946   471 SRNLLQPVDtSFdQSRCKMHDLLRQLAWY-LSREecyigdlkplvaNTI- 518  

                   hdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtseieeeln.Ise
                    +    R   v  ++   V   +TG +      I l t  ++++l +++ 
  gi|1427946   519 -C-KLRRMLVVGEKDT--VVIPCTGKQE-----IKLRTFTTDHQLQgVDN 559  

                   kAFegMrNLqFLriykksfrddgk<-*
                     F +++ L+ L   ++    ++    
  gi|1427946   560 TFFMRLTHLRVLDLSDS--LVQTI    581  

gi|7488989|pir||T07589: domain 1 of 1, from 1089 to 1488: score -198.1, E = 0.019
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      r  +++ G  + + ++k  L   s  e   + I G +G GKTT A+ 
  gi|7488989  1089    RANEEMEGFQDTIDELKDKLLGGS-PELDVISIVGMPGLGKTTLAKK 1134 

                   Lfs..qLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyG
                    ++++        s+F  +a                  t       Ys  
  gi|7488989  1135 IYNdpEVT-----SRFDVHAQCV--------------VTQL-----YS-- 1158 

                   mKLhLQeqfLSkILn..........qkDikIhdHLGvieERLkdqKVLIi
                       ++e +L  ILn+  +++++++++D +I d L   +  L  ++ LI 
  gi|7488989  1159 ----WRELLL-TILNdvlepsdrneKEDGEIADEL---RRFLLTKRFLIL 1200 

                   LDDVDdleQLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgf
                   +DDV d ++ d L    +   + SRII TT      +    +    +  +
  gi|7488989  1201 IDDVWDYKVWDNLCMCFSDVSNRSRIILTTRLNDVAEYVKCESDPHHLRL 1250 

                   PSkeeALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsL
                     ++e  + +    F   s p   e+   +e+ k +  LPL    +   L
  gi|7488989  1251 FRDDESWTLLQKEVFQGESCPPELEDV-GFEISKSCRGLPLSVVLVAGVL 1299 

                   R..GkskeeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLh
                   +++ k+ + W+ +   L +   +sL + I ++  +sY  L +  +  FL+
  gi|7488989  1300 KqkKKTLDSWKVVEQSLSSQRIGSLEESI-SIIGFSYKNLPHYLKPCFLY 1348 

                   IACfFNgekvdyV....kalLadsnnLDVrqG..........LkvLadKS
                      f  g++  +V++ +k + a+  ++  ++ ++++++ ++ L  L  + 
  gi|7488989  1349 FGGFLQGKD-IHVskmtKLWVAEG-FVQANNEkgqedtaqgfLDDLIGRN 1396 

                   LIhisplgnedkv.dgtieMHnLLqqLGReAIVrkQsidhdePgKRqFLv
                    +   +++ +  ++ +t++ H+LL ++  e    kQ+ d        FL 
  gi|7488989  1397 VVMAMEKRPN--TkVKTCRIHDLLHKFCME--KAKQE-D--------FLL 1433 

                   DaeeIcdVLtdnTGtgtrsVlGIslDtseieeelnIsekAFegMrNLqFL
                     +    V+ +            +l ++  ++e++    +    r L+F 
  gi|7488989  1434 QINSGEGVFPERLEEY-------RLFVHSYQDEIDLWRPSRSNVRSLLFN 1476 

                   riykksfrddgk<-*
                    i+ +   +      
  gi|7488989  1477 AIDPDNLLWPRD    1488 

gi|8547232|gb|AAF76308.1|: domain 1 of 1, from 1089 to 1488: score -198.1, E = 0.019
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      r  +++ G  + + ++k  L   s  e   + I G +G GKTT A+ 
  gi|8547232  1089    RANEEMEGFQDTIDELKDKLLGGS-PELDVISIVGMPGLGKTTLAKK 1134 

                   Lfs..qLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyG
                    ++++        s+F  +a                  t       Ys  
  gi|8547232  1135 IYNdpEVT-----SRFDVHAQCV--------------VTQL-----YS-- 1158 

                   mKLhLQeqfLSkILn..........qkDikIhdHLGvieERLkdqKVLIi
                       ++e +L  ILn+  +++++++++D +I d L   +  L  ++ LI 
  gi|8547232  1159 ----WRELLL-TILNdvlepsdrneKEDGEIADEL---RRFLLTKRFLIL 1200 

                   LDDVDdleQLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgf
                   +DDV d ++ d L    +   + SRII TT      +    +    +  +
  gi|8547232  1201 IDDVWDYKVWDNLCMCFSDVSNRSRIILTTRLNDVAEYVKCESDPHHLRL 1250 

                   PSkeeALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsL
                     ++e  + +    F   s p   e+   +e+ k +  LPL    +   L
  gi|8547232  1251 FRDDESWTLLQKEVFQGESCPPELEDV-GFEISKSCRGLPLSVVLVAGVL 1299 

                   R..GkskeeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLh
                   +++ k+ + W+ +   L +   +sL + I ++  +sY  L +  +  FL+
  gi|8547232  1300 KqkKKTLDSWKVVEQSLSSQRIGSLEESI-SIIGFSYKNLPHYLKPCFLY 1348 

                   IACfFNgekvdyV....kalLadsnnLDVrqG..........LkvLadKS
                      f  g++  +V++ +k + a+  ++  ++ ++++++ ++ L  L  + 
  gi|8547232  1349 FGGFLQGKD-IHVskmtKLWVAEG-FVQANNEkgqedtaqgfLDDLIGRN 1396 

                   LIhisplgnedkv.dgtieMHnLLqqLGReAIVrkQsidhdePgKRqFLv
                    +   +++ +  ++ +t++ H+LL ++  e    kQ+ d        FL 
  gi|8547232  1397 VVMAMEKRPN--TkVKTCRIHDLLHKFCME--KAKQE-D--------FLL 1433 

                   DaeeIcdVLtdnTGtgtrsVlGIslDtseieeelnIsekAFegMrNLqFL
                     +    V+ +            +l ++  ++e++    +    r L+F 
  gi|8547232  1434 QINSGEGVFPERLEEY-------RLFVHSYQDEIDLWRPSRSNVRSLLFN 1476 

                   riykksfrddgk<-*
                    i+ +   +      
  gi|8547232  1477 AIDPDNLLWPRD    1488 

gi|6520229|dbj|BAA87956.1|: domain 1 of 1, from 134 to 550: score -198.1, E = 0.019
                   *->rDFddlVGiEaHlekmk.sLLcLdskdeVrMVGIwGPaGIGKTTIAR
                      +    lVG+E   +k+ + L   +   +V  V I G  GIGKTT AR
  gi|6520229   134    NNESVLVGLEENVKKLVgHLVEVEDSSQV--VSITGMGGIGKTTLAR 178  

                   ALfs..qLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsy
                     f+++        s F   a +  +                       +
  gi|6520229   179 QVFNheTVK-----SHFAQLAWVCVSQQ---------------------F 202  

                   GmKLhLQeqfLSkILnqkDikIhdHLGvieERLkdq........KVLIiL
                     K  +Q      IL++ + +    L   e+ L+ +  +  +++K LI+L
  gi|6520229   203 TRKYVWQT-----ILRKVGPEYI-KLEMTEDELQEKlfrllgtrKALIVL 246  

                   DDV...DdleQLdALAketqWFGpGSRIIVTTeDkqL.LkaHgInhtIYe
                   DD+ +++d +  + +       G G  +  T  +    L+a      I +
  gi|6520229   247 DDIwreEDWDMIEPIFP----LGKGWKVLLTSRNEGVaLRANPNGF-IFK 291  

                   VgfPSkeeALqIFCrsAF.gQns....PpdGFeeLeAreVtkLaGnLPLG
                    +  + ee  +IF r  F+g+n+++ +  +  eeL  ++ +k++G LPL+
  gi|6520229   292 PDCLTPEESWTIFRRIVFpGENTteykVDEKMEEL-GKQMIKHCGGLPLA 340  

                   LrVlGSsLR.GkskeeWedmLpRLrtsf..gnsLDgkIek....vLrvsY
                   L+VlG  L    + +eW+++   +++ + +g s ++k +++  ++L  s+
  gi|6520229   341 LKVLGGLLVvHFTLDEWKRIYGNIKSHIvgGTSFNDKNMSsvyhILHLSF 390  

                   DgLhekDqaLFLhIACfFNgekvdyVkalLadsnnLDVrqGLkvLadKSL
                   ++L    +  FL+ A f   +++d+ k     s                 
  gi|6520229   391 EELPIYLKHCFLYLAQFPEDFTIDLEK----LS----------------- 419  

                   Ihisplgne.........................................
                        +  e+ ++++  ++ + ++ +++  ++  +++   ++++ +++++
  gi|6520229   420 ---YYWAAEgmprpryydgatirkvgdgyieelvkrnmviserdaskprr 466  

                   ................d.kvdgtieMHnLLqqLGReAIVrkQsidhdePg
                      +++++++ +++ +++k+          ++LG     r  ++      
  gi|6520229   467 lvvkggdktdmegklkNpKLRSLLFI----EELGGY---RGFEV----WF 505  

                   KRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtseieeelnIsekAFegM
                    R  L+   + + V   + G +        l  s i+  l I+       
  gi|6520229   506 TRLQLMRVLDLHGV---EFGGE--------LP-SSIG--LLIH------- 534  

                   rNLqFLriykksfrddgk<-*
                     L++L+ y+ + ++ +    
  gi|6520229   535 --LRYLSLYRAKASHLPS    550  

gi|13487351|gb|AAK27507.1|: domain 1 of 1, from 189 to 555: score -198.2, E = 0.019
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrM.....VGIwGPaGIGKT
                      rD d +V         + LL      e+   + ++  I G  G GK+
  gi|1348735   189    RDRDRIV---------DFLLGKTTTAEASSakysgLAIVGLGGMGKS 226  

                   TIARALfs..qLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglD
                   T A   ++++++      + F  +  +  +r                 lD
  gi|1348735   227 TLAQYVYNdkRIE-----ECFDIRMWVCISR----------------KLD 255  

                   eYsyGmKLhLQeqfLSkIL..nqkDi..kIhdHLGvieERLkd.....qK
                    +        + +   +I+++ +k+  ++++ +L +++  L+d  +++qK
  gi|1348735   256 VHR-------HTR---EIIesAKKGEcpRVD-NLDTLQCKLRDilqesQK 294  

                   VLIiLDDV........DdleQLdA.LAketqWFGpGSRIIVTTeDkqLLk
                    L++LDDV  ++++++   e+L A+L+ +     +GS + VTT    L  
  gi|1348735   295 FLLVLDDVwfeksdteTEWELLLApLVSKQ----SGSKVLVTTRRETLPA 340  

                   aHgInhtIYeVgfPSkeeALqIFCrsAF.....gQnsPpdGFeeLeAreV
                   a   +  + + +   + e L  F  +AF++ + +    +  Fe+  ++e+
  gi|1348735   341 AVCCEQ-VVHLKNLDDTELLALFKHHAFsgaeiKDQLLHTKFEHT-TEEI 388  

                   tkLaGnLPLGLrVlGSsLRG.kskeeWedmLpRLrtsfgnsLDgkIekvL
                   +k+ G  PL+ +VlGS L ++k+  eW+ +L  L        D      L
  gi|1348735   389 AKRLGQCPLAAKVLGSRLCRkKDIAEWKAALK-LGD----LSDPF--TSL 431  

                   rvsYDgLhekDqaLFLhIACfFN.gekv..dyVkalLadsnnLDVrqGLk
                     sY++L+ + q  FL+   f  +++ +++ +V+ + a+       +G +
  gi|1348735   432 LWSYEKLDPRLQRCFLYCSLFPKgHRYDpnQLVHLWVAEG-----FVGSC 476  

                   vLadKSLIhisplgne..........dkvdgtieMHnLLqqLGReAIVrk
                   +L  + L    +  ++ ++  +++  +   ++ +MH+ L  ++ e     
  gi|1348735   477 NLSRRTLEEAGM--DYfndmvsgsffQWYGRYYVMHDILHDFA-E----- 518  

                   QsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtseieeeln
                    s              ++e c  L d+  t+             i     
  gi|1348735   519 -SL-------------SREDCFRLKDDNVTE-------------IP---- 537  

                   IsekAFegMrNLqFLriykksfrddgk<-*
                            +  + L+++  s +++++   
  gi|1348735   538 ---------CTVRHLSVHVQSMQKHKQ    555  

gi|12744955|gb|AAK06858.1|: domain 1 of 1, from 189 to 557: score -198.5, E = 0.02
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrM.....VGIwGPaGIGKT
                      rD d +V         + LL      e+   + ++  I G  G GK+
  gi|1274495   189    RDRDRIV---------DFLLGKTTTAEASSakysgLAIVGLGGMGKS 226  

                   TIARALfs..qLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglD
                   T A   ++++++      + F  +  +  +r                 lD
  gi|1274495   227 TLAQYVYNdkRIE-----ECFDIRMWVCISR----------------KLD 255  

                   eYsyGmKLhLQeqfLSkILnqkDi..kIhdHLGvieERLkd.....qKVL
                    +      h +e + S    +k+  ++++ +L +++  L+d  +++qK L
  gi|1274495   256 VHR-----HTREIMES---AKKGEcpRVD-NLDTLQCKLRDilqesQKFL 296  

                   IiLDDV......Ddle...QLdALAketqWFGpGSRIIVTTeDkqLLka.
                   ++LDDV  +++++  e + +L  L+ +     +GS + VT   k L  a 
  gi|1274495   297 LVLDDVwfekshNETEwelFLAPLVSKQ----SGSKVLVTSRSKTLPAAi 342  

                   .....HgInhtIYeVgfPSkeeALqIFCrsAFgQnsPpdGFe..eL..eA
                     +++H I ++    +   + e L  F  +AF     +d   +++L++ A
  gi|1274495   343 cceqeHVIHLE--NMD---DTEFLALFKHHAFSGAEIKDQLLrtKLedTA 387  

                   reVtkLaGnLPLGLrVlGSsLRG.kskeeWedmLpRLrtsfgnsLDgkIe
                   +e++k+ G  PL+ +VlGS L ++k+  eW+ +L  L        D    
  gi|1274495   388 EEIAKRLGQCPLAAKVLGSRLCRkKDIAEWKAALK-LGD----LSDPF-- 430  

                   kvLrvsYDgLhekDqaLFLhIACf..FN.gekvdyVkalLadsnnLDVrq
                     L  sY++L+ + q  FL+   f++ ++++  ++V+ + a+       +
  gi|1274495   431 TSLLWSYEKLDPRLQRCFLYCSLFpkGHgYRPEELVHLWVAEG-----FV 475  

                   GLkvLadKSLIhisplgne..........dkvdgtieMHnLLqqLGReAI
                   G ++L  + L    +  ++ ++  +++  ++  ++ +MH+ L  ++ e  
  gi|1274495   476 GSCNLSRRTLEEAGM--DYfndmvsgsffQRYGRYYVMHDILHDFA-E-- 520  

                   VrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtseiee
                       s              ++e c  L+d+  t+             i  
  gi|1274495   521 ----SL-------------SREDCFRLEDDNVTE-------------IP- 539  

                   elnIsekAFegMrNLqFLriykksfrddgk<-*
                               +  + L+++  s +++++   
  gi|1274495   540 ------------CTVRHLSVHVQSMQKHKQ    557  

gi|4092771|gb|AAC99464.1|: domain 1 of 1, from 174 to 579: score -198.9, E = 0.021
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         + lVGi+a   k+   L L  + ++  V + G  G GKTT    
  gi|4092771   174    ---NSLVGIDAAKGKLIGWL-LSPEPQRIVVSVVGMGGSGKTT---- 212  

                   LfsqLSerhFq.ssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGm
                   L   +++++  ++ F   a ++ +++sy  e+++       ++ e +  +
  gi|4092771   213 LSANIFKSQTVrKHFASYAWVT-ISKSYVIEDVFR-----TMIKEFYKEA 256  

                   KLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLd
                     +   ++ S   +     ++  L    E L+ ++ ++ LDDV +  +  
  gi|4092771   257 ETQIPGELYSLTYREL---VE-KL---VEYLHSKRYFVMLDDVWNTGLWR 299  

                   ....ALAketqWFGpGSRIIVTT..eDkqLL......kaHgInhtIYeVg
                   + + AL + +    +GSR+ VTT++++   ++ +++++ H+I++   +  
  gi|4092771   300 eisiALPDGI----SGSRVMVTTrsNNMASFsygsgsRKHEIELL--K-- 341  

                   fPSkeeALqIFCrsAFg...QnsPpdGFeeLeAreVtkLaGnLPLGLrVl
                      ++eA   FC  AF ++ +   +   e   Ar+ ++++  LPL+   l
  gi|4092771   342 ---EDEAWALFCNKAFSgslEECRRRNLEVV-ARKLVERCQGLPLAIASL 387  

                   GSsLR.GkskeeWedmLpRLrtsfgnsLDgkIe.....kvLrvsYDgLhe
                   GS + + + + eW+ +   L       L+ + e +  +++L  s+ +L  
  gi|4092771   388 GSMMStKRLESEWKQVYNSLNW----ELNNNLElkvvrSILLLSFSDLPY 433  

                   kDqaLFLhIACfF....N.gekvdyVkalLadsnnLDVrqG.........
                     +  FL+  C+F+ + + ++k ++V  + a   ++    G + ++  ++
  gi|4092771   434 PLKRCFLY-CCLFpvnyRmKRK-KLVRMWMAQR-FVEPIRGvkaeevadg 480  

                   .LkvLadKSLIhisplgnedkvdgtieMHnLLqqLGReAIVrkQsidhde
                    L+ L+++   ++  ++   +  +  +MH+  ++ +   I  ++ +    
  gi|4092771   481 yLNELVYRNMLQVILWNPFGR-PKVFKMHDVIREIALS-ISKAERF---- 524  

                   PgKRqFLvDaeeIcdV...........LtdnTGtgtrsVlGIslDtseie
                                cdV+++++++++ + +++ Gt+         +++ i+
  gi|4092771   525 -------------CDVngdddddddaeTAEDHGTR---------HLC-IQ 551  

                   eelnIsekAFegMrNLqFLriykksfrddgk<-*
                   +e  +    +++ +NL  L + +k ++  ++   
  gi|4092771   552 KE--MRSGTLRR-TNLHTLLVCTKHSIELPP    579  

gi|13310480|gb|AAK18308.1|: domain 1 of 1, from 187 to 559: score -199.1, E = 0.022
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrM......VGIwGPaGIGK
                      rD d     ++H+   + LL+     ++  + + ++  I G  G GK
  gi|1331048   187    RDRD-----RDHI--VDFLLDKTTTAQA-TsakysgLAIVGVGGMGK 225  

                   TTIARALfs..qLSerhFqssFqlsaFmenlrgsyskeeigSgetrpagl
                   +T A   ++++++      + F  +  +  +r                 l
  gi|1331048   226 STLAQYVYNdkRIE-----ECFDVRMWVCISR----------------KL 254  

                   DeYsyGmKLhLQeqfLSkILnqkDi..kIhdHLGvieERLkd.....qKV
                   D +      h +e + S    +k+  ++++ +L +++  L+d  ++++K 
  gi|1331048   255 DVRR-----HTREIMES---AKKGEcpRVD-NLDTLQCKLRDilqesHKF 295  

                   LIiLDDV........DdleQLdA.LAketqWFGpGSRIIVTTeDkqLLka
                   L++LDDV  ++++++   e+L A+L+ +     pGS + VTT    L  a
  gi|1331048   296 LLVLDDVwfeksdteTEWELLLApLVSKQ----PGSKVLVTTRRETLPAA 341  

                   HgInhtIYeVgfPSkeeALqIFCrsAFgQnsPpdGFe..eL..eAreVtk
                      +  + + +   + e L  F  +AF     +d   +++L++ ++e++k
  gi|1331048   342 VCCEQ-VVHLKNLDDTEFLALFKHHAFSGAEIKDQLLhtKLehTTEEIAK 390  

                   LaGnLPLGLrVlGSsLRG.kskeeWedmLpRLrtsfgnsLDgkIekvLrv
                   + G  PL+ +VlGS L ++k+  eW+ +L  L        D      L  
  gi|1331048   391 RLGQCPLAAKVLGSRLCRkKDIAEWKAALK-LGD----LSDPF--TSLLW 433  

                   sYDgLhekDqaLFLhIACf...FNgekvdyVkalLadsnnLDVrqGLkvL
                   sY++L+ + q  FL+   f+++ ++e   +V+ + a+       +G ++L
  gi|1331048   434 SYEKLDPRLQRCFLYCSLFpkgHRYEPNQLVHLWVAEG-----FVGSCNL 478  

                   adKSLIhisplgne............d.kv.dgtieMHnLLqqLGReAIV
                     + L    +  ++ ++  ++   + ++k +  +  MH+ L  L+ e   
  gi|1331048   479 SRRTLEEAGM--DYfndmvsgfffqlVsKRhYSYYIMHDILHDLA-E--- 522  

                   rkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtseieee
                      s              ++e c  L+d+  t+             i   
  gi|1331048   523 ---SL-------------SREDCFRLEDDNVTE-------------IP-- 541  

                   lnIsekAFegMrNLqFLriykksfrddgk<-*
                              +  ++ ++   s +++++   
  gi|1331048   542 -----------CTVRYISVRVESMQKHKE    559  

gi|6633843|gb|AAF19702.1|AC008047_9: domain 1 of 1, from 153 to 496: score -199.2, E = 0.022
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                           +VG E  l +     +L   d+V + G +G  G+GKTT    
  gi|6633843   153    -----IVGQETMLDNAWN--HLME-DGVGIMGLYGMGGVGKTTLLTQ 191  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                     +++S  ++   F   + +  +++           + ++ lDe     K
  gi|6633843   192 INNKFS--KYMCGFDSVIWVVVSKE----------VNVENILDEIA--QK 227  

                   LhLQeqfLSkILnqkDikIhdHLGv.ieERLkdqKVLIiLDDV.DdleQL
                    h   +       + D k   + Gv + + L+ ++  ++LDD+ +++ + 
  gi|6633843   228 VHISGE-------KWDTKYKYQKGVyLYNFLRKMRFVLFLDDIwEKVNLV 270  

                   d......ALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSke
                   + + + +++ +          ++ TT       + g++    eV    + 
  gi|6633843   271 EigvpfpTIKN-------KCKVVFTTRSLDVCTSMGVEKP-MEVQCLADN 312  

                   eALqIFCrsAFgQnsPp..dGFeeLeAreVtkLaGnLPLGLrVlGSsLR.
                   +A   F +   gQ +  ++    eL +r V+k +  LPL+L+V+   +  
  gi|6633843   313 DAYDLF-QKKVGQITLGsdPEIREL-SRVVAKKCCGLPLALNVVSETMSc 360  

                   GkskeeWedmLpRLrtsfg...nsLDgkIekvLrvsYDgLhekDqaLFLh
                    ++ +eW  ++  L + +  +  + D+kI   L+ sYD+L  +D  + L+
  gi|6633843   361 KRTVQEWRHAIYVLNS-YAakfSGMDDKILPLLKYSYDSLKGEDVKMCLL 409  

                   IACfFNgekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvd
                      +F +   +  k+ L +                  I  +  +      
  gi|6633843   410 YCALFPEDA-KIRKENLIEY----------------WICEEIID------ 436  

                   gtieMHnLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGt
                               G e I+ ++  + +e      Lv a      L ++   
  gi|6633843   437 ------------GSEGIDKAENQG-YEIIGS--LVRAS----LLMEEVE- 466  

                   gtrsVlGIslDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                            lD  +i   l+    + + M     L+i  ++ +  +    
  gi|6633843   467 ---------LDGANIV-CLHD---VVREMA----LWIASDLGKQNEA    496  

gi|12324358|gb|AAG52150.1|AC022355_11: domain 1 of 1, from 153 to 496: score -199.2, E = 0.022
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                           +VG E  l +     +L   d+V + G +G  G+GKTT    
  gi|1232435   153    -----IVGQETMLDNAWN--HLME-DGVGIMGLYGMGGVGKTTLLTQ 191  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                     +++S  ++   F   + +  +++           + ++ lDe     K
  gi|1232435   192 INNKFS--KYMCGFDSVIWVVVSKE----------VNVENILDEIA--QK 227  

                   LhLQeqfLSkILnqkDikIhdHLGv.ieERLkdqKVLIiLDDV.DdleQL
                    h   +       + D k   + Gv + + L+ ++  ++LDD+ +++ + 
  gi|1232435   228 VHISGE-------KWDTKYKYQKGVyLYNFLRKMRFVLFLDDIwEKVNLV 270  

                   d......ALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSke
                   + + + +++ +          ++ TT       + g++    eV    + 
  gi|1232435   271 EigvpfpTIKN-------KCKVVFTTRSLDVCTSMGVEKP-MEVQCLADN 312  

                   eALqIFCrsAFgQnsPp..dGFeeLeAreVtkLaGnLPLGLrVlGSsLR.
                   +A   F +   gQ +  ++    eL +r V+k +  LPL+L+V+   +  
  gi|1232435   313 DAYDLF-QKKVGQITLGsdPEIREL-SRVVAKKCCGLPLALNVVSETMSc 360  

                   GkskeeWedmLpRLrtsfg...nsLDgkIekvLrvsYDgLhekDqaLFLh
                    ++ +eW  ++  L + +  +  + D+kI   L+ sYD+L  +D  + L+
  gi|1232435   361 KRTVQEWRHAIYVLNS-YAakfSGMDDKILPLLKYSYDSLKGEDVKMCLL 409  

                   IACfFNgekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvd
                      +F +   +  k+ L +                  I  +  +      
  gi|1232435   410 YCALFPEDA-KIRKENLIEY----------------WICEEIID------ 436  

                   gtieMHnLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGt
                               G e I+ ++  + +e      Lv a      L ++   
  gi|1232435   437 ------------GSEGIDKAENQG-YEIIGS--LVRAS----LLMEEVE- 466  

                   gtrsVlGIslDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                            lD  +i   l+    + + M     L+i  ++ +  +    
  gi|1232435   467 ---------LDGANIV-CLHD---VVREMA----LWIASDLGKQNEA    496  

gi|12744957|gb|AAK06859.1|: domain 1 of 1, from 187 to 561: score -199.3, E = 0.022
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrM......VGIwGPaGIGK
                      rD d     ++H+   + LL+     ++  + + ++  I G  G GK
  gi|1274495   187    RDRD-----RDHI--VDFLLDKTTTAQA-TsakysgLAIVGLGGMGK 225  

                   TTIARALfs..qLSerhFqssFqlsaFmenlrgsyskeeigSgetrpagl
                   +T A   ++++++      + F  +  +  +r                 l
  gi|1274495   226 STLAQYVYNdkRIE-----ECFDIRMWVCISR----------------KL 254  

                   DeYsyGmKLhLQeqfLSkILnqkDi..kIhdHLGvieERLkd.....qKV
                   D +      h +e + S    +k+  ++++ +L +++  L+d  +++qK 
  gi|1274495   255 DVHR-----HTREIMES---AKKGEcpRVD-NLDTLQCKLRDilqesQKF 295  

                   LIiLDDV......Ddle...QLdALAketqWFGpGSRIIVTTeDkqLLka
                   L++LDDV  +++++  e + +L  L+ +     +GS + VT   k L  a
  gi|1274495   296 LLVLDDVwfekshNETEwelFLAPLVSKQ----SGSKVLVTSRSKTLPAA 341  

                   ......HgInhtIYeVgfPSkeeALqIFCrsAFgQnsPpdGFe..eL..e
                      +++H I ++    +   + e L  F  +AF     +d   +++L++ 
  gi|1274495   342 icceqeHVIHLE--NMD---DTEFLALFKHHAFSGAEIKDQLLrtKLedT 386  

                   AreVtkLaGnLPLGLrVlGSsLRG.kskeeWedmLpRLrtsfgnsLDgkI
                   A+e++k+ G  PL+ +VlGS L ++k+  eW+ +L  L        D   
  gi|1274495   387 AEEIAKRLGQCPLAAKVLGSRLCRkKDIAEWKAALK-LGD----LSDPF- 430  

                   ekvLrvsYDgLhekDqaLFLhIACf...FNgekvdyVkalLadsnnLDVr
                      L  sY++L+ + q  FL+   f+++ ++e  ++V+ + a+       
  gi|1274495   431 -TSLLWSYEKLDPRLQRCFLYCSLFpkgHRYEPNELVHLWVAEG-----F 474  

                   qGLkvLadKSLIhisplgne............d.kv.dgtieMHnLLqqL
                   +G ++L  + L    +  ++ ++  ++   + ++k +  +  MH+ L  L
  gi|1274495   475 VGSCNLSRRTLEEAGM--DYfndmvsgfffqlVsKRhYSYYIMHDILHDL 522  

                   GReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDt
                   + e      s              ++e c  L+d+  t+           
  gi|1274495   523 A-E------SL-------------SREDCFRLEDDNVTE----------- 541  

                   seieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                     i              +  ++ ++   s +++++   
  gi|1274495   542 --IP-------------CTVRYISVRVESMQKHKE    561  

gi|3056599|gb|AAC13910.1|AAC13910: domain 1 of 1, from 150 to 544: score -200.2, E = 0.024
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      r     +G E  lek     +L   d+V + G  G  G+GKTT  + 
  gi|3056599   150    RPTQPTIGQEEMLEKAWN--RLME-DGVGIMGLHGMGGVGKTTLFKK 193  

                   LfsqLSerhFq.ssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGm
                    ++++ e    +  F   + +  + g              + l e     
  gi|3056599   194 IHNKFAE---IgGTFDIVIWIVVSQG-----------AKLSKLQED-IAE 228  

                   KLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLd
                   KLhL        L ++  + +     i   Lk ++  + LDD+   + L+
  gi|3056599   229 KLHLCDD-----LWKNKNESD-KATDIHRVLKGKRFVLMLDDIWEKVDLE 272  

                   AL.......AketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSke
                   A++ + +++++          +  TT  ++     g      +V     e
  gi|3056599   273 AIgipypseVN-------KCKVAFTTRSREVCGEMGDHKP-MQVNCLEPE 314  

                   eALqIFCrsAFgQnsPpdG..FeeLeAreVtkLaGnLPLGLrVlGSsLRG
                   +A + F     g n+   ++    L AreV+  +  LPL+L+V G  +  
  gi|3056599   315 DAWELF-KNKVGDNTLSSDpvIVGL-AREVAQKCRGLPLALNVIGETMAS 362  

                   ksk.eeWedmLpRLrtsfg..nsLDgkIekvLrvsYDgLhek.DqaLFLh
                   k+  +eWe ++  L  s  +  +   kI  +L+ sYD+L +++ ++ FL+
  gi|3056599   363 KTMvQEWEYAIDVLTRSAAefSGMENKILPILKYSYDSLGDEhIKSCFLY 412  

                   IACfFN.gekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgne...
                    A f  +g++    ++ L d+                LI     g+++  
  gi|3056599   413 CALFPEdGQI---YTETLIDK----------------LICEGFIGEDqvi 443  

                   ...............................dkv.dgtieMHnLLqqLGR
                   ++ ++++    ++ ++ +  ++ +++  +   kv+  +++MH+  ++++ 
  gi|3056599   444 krarnkgyamlgtltranlltkvgtelanllTKVsIYHCVMHDVVREMAL 493  

                   eAIVrkQsidhdePgKRq..FLvDaeeIcdVLtdnTGtgtrsVlGIslDt
                     I         + gK +++F v a             g          +
  gi|3056599   494 W-I-------ASDFGKQKenFVVQAS-----------AG----------L 514  

                   seieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   +ei  e+     A ++M+  +  +i +    ++ k   
  gi|3056599   515 HEIP-EVKD-WGAVRRMSLMRN-EIEEI--TCESK    544  

gi|7489349|pir||T30560: domain 1 of 1, from 146 to 538: score -200.3, E = 0.025
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                       D +d+   E   +  + L  L+  ++  M+  +G  G+GKTT    
  gi|7489349   146    TDYNDFQSREK--TFTQALKALEPNNASHMIALCGMGGVGKTTMMQR 190  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L           +  +s  +e + g   +        +   + +Y   + 
  gi|7489349   191 LKKVAK-----QNRMFSYMVEAVIGEKTDP-----IAIQQAVADY---LR 227  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLk......dqKVLIiLDDVDd
                     L e         k  + +  L   +E+ k +++++  K L+iLDDV +
  gi|7489349   228 IELKES-------TKPARAD-KL---REWFKansgegKNKFLVILDDVWQ 266  

                   leQLdALAketqWF...GpGSRIIVTTeDkqLLkaHgInht.IYeVgfPS
                   ++ L+ +    + F+++G    +  T  D +     g+  ++I  Vg+  
  gi|7489349   267 SVDLEDIGL--SPFpnqGVDFKVLLTSRDEHVCTVMGVGSNsILNVGLLI 314  

                   keeALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRG
                   + eA   F +  F ++s p+   ++  + +++ +  LP + + +   LR 
  gi|7489349   315 EAEAQSLFQQ--FVETSEPEL-HKI-GEDIVRKCCGLPIAIKTMACTLRN 360  

                   kskeeWedmLpRLrtsfgnsLDgkIe.kvLrvsYDgLhek.DqaLFLhIA
                   k k+ W+d+L R++      L +++ +kv   sY  Lh+k+ ++ FL   
  gi|7489349   361 KRKDAWKDALSRIEH---YDL-RNVApKVFETSYHNLHDKeTKSVFLMCG 406  

                   Cf...FNgekvdy......VkalLadsnnLDVrqGLkvLadK.....SLI
                    f+++FN  + ++ + + ++k +     +   r++ ++  ++  +++ LI
  gi|7489349   407 LFpedFNIPTEELmrygwgLKIFDRVYTFIEARNRINTCIERlvqtnLLI 456  

                   hisplgnedkvdgtieMHnLLq..qLGReAIVrkQsidhdePgKRqFLvD
                     ++        g+++MH+L +   LG    V + s+           v+
  gi|7489349   457 ESDD-------VGCVKMHDLVRafVLGMYSEVEHASV-----------VN 488  

                   aeeIcdVLtdnTGtgtrsVlGIslDtseieeelnIsekAFegMrNLqFLr
                      I    +++  +++++   Isl    ++   nI    F+  +NL  L+
  gi|7489349   489 HGNIPGWTENDPTDSCKA---ISLTCESMS-G-NI-PGDFK-FPNLTILK 531  

                   iykksfrddgk<-*
                           d+    
  gi|7489349   532 LMHG----DKS    538  

gi|12744961|gb|AAK06860.1|: domain 1 of 1, from 189 to 557: score -201.3, E = 0.028
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrM.....VGIwGPaGIGKT
                      rD d +V         + LL      e+   + ++  I G  G GK+
  gi|1274496   189    RDRDRIV---------DFLLGKTTTAEASSakysgLAIVGLGGMGKS 226  

                   TIARALfs..qLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglD
                   T A   ++++++      + F  +  +  +r                 lD
  gi|1274496   227 TLAQYVYNdkRIE-----ECFDIRMWVCISR----------------KLD 255  

                   eYsyGmKLhLQeqfLSkILnqkD..ikIhdHLGvieERLkd.....qKVL
                    +      h +e + S    +k++  +++ +L +++  L+d  +++qK L
  gi|1274496   256 VHR-----HTREIMES---AKKGecRRVD-NLDTLQCKLRDilqesQKFL 296  

                   IiLDDV......Ddle...QLdALAketqWFGpGSRIIVTTeDkqLL...
                   ++LDDV  +++++  e + +L  L+ +     +GS + VT   k L  + 
  gi|1274496   297 LVLDDVwfekshNETEwelFLAPLVSKQ----SGSKVLVTSRSKTLPasi 342  

                   ...kaHgInhtIYeVgfPSkeeALqIFCrsAFgQnsPpdGFe..eL..eA
                     ++ H I ++    +   + e L  F  +AF     +d   +++L++ A
  gi|1274496   343 cceQEHVIHLE--NMD---DTEFLALFKHHAFSGAEIKDQLLrtKLedTA 387  

                   reVtkLaGnLPLGLrVlGSsLRG.kskeeWedmLpRLrtsfgnsLDgkIe
                   +e++k+ G  PL+ +VlGS L ++k+  eW+ +   L+ +    L  +  
  gi|1274496   388 EEIAKRLGQCPLAAKVLGSRLCRkKDIAEWKTA---LKIG---DL-SDPF 430  

                   kvLrvsYDgLhekDqaLFLhIACfFN.gekv..dyVkalLadsnnLDVrq
                     L  sY++L+ + q  FL+   f  ++  +++++V+ + a+       +
  gi|1274496   431 TSLLWSYEKLDPRLQRCFLYCSLFPKgHVYRpqELVHLWVAEG-----FV 475  

                   GLkvLadKSLIhisplgne..........dkvdgtieMHnLLqqLGReAI
                   G ++L  + L    +  ++ ++  +++  +   ++ +MH+ L  ++ e  
  gi|1274496   476 GSCNLSRRTLEEAGM--DYfndmvsgsffQWYGRYYVMHDILHDFA-E-- 520  

                   VrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtseiee
                       s              ++e c  L d+  t+             i  
  gi|1274496   521 ----SL-------------SREDCFRLKDDNVTE-------------IP- 539  

                   elnIsekAFegMrNLqFLriykksfrddgk<-*
                               +  + L+++  s +++++   
  gi|1274496   540 ------------CTVRHLSVHVQSMQKHKQ    557  

gi|8118130|gb|AAF72906.1|: domain 1 of 1, from 1 to 157: score -201.9, E = 0.03
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                                  A A
  gi|8118130     1    ------------------------P-------------------ATA 4    

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L++++S     ++F   + ++ ++++y          r+   D       
  gi|8118130     5 LYNKIS-----HQFSVYCLIDDVSKIY----------RH---DGP----- 31   

                   LhLQeqfLSkILnqkDikIhdHL....GvieERLkdqKVLIiLDDVDdle
                    + Q+q L + L+ ++++ + +L + +  i+ RL++ K LIiLD VD++e
  gi|8118130    32 MSAQKQILCQTLGEEHLQMC-NLynasNLIRSRLRHVKSLIILDNVDHVE 80   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   QL+ LA   +W G GSRII+TT D ++Lk +g++  +Y+V +  +   Lq
  gi|8118130    81 QLEKLAVSREWLGAGSRIIITTRDEHILKVYGVDV-VYKVPLLNNTNSLQ 129  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    F + AF+ +    G+ +L                               
  gi|8118130   130 LFSQKAFKLDHIISGYDKL------------------------------- 148  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                                                                     
  gi|8118130     - -------------------------------------------------- -    

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                                                                     
  gi|8118130     - -------------------------------------------------- -    

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                        A                                            
  gi|8118130   149 -----A-------------------------------------------- 149  

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                           ++I                      +  +   
  gi|8118130   150 --------FDI---------------------LSYAN    157  

gi|6633842|gb|AAF19701.1|AC008047_8: domain 1 of 1, from 153 to 555: score -202.0, E = 0.03
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                           +VG +  l k     +L   d+V + G +G  G+GKTT    
  gi|6633842   153    -----IVGQDTMLDKAGK--HLME-DGVGIMGMYGMGGVGKTTLLTQ 191  

                   LfsqLSerhFq.ssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGm
                   L++ + +   ++  F   + +  + + +           ++  De     
  gi|6633842   192 LYNMFNK---DkCGFDIGIWVVVSQEFH----------VEKVQDEIA--Q 226  

                   KLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDV.DdleQL
                   KL L      + + ++  +    +  + + L+ +   ++LDD+ ++++  
  gi|6633842   227 KLGLGGD---EWTQKDKSQKG-IC--LYNILREKSFVLFLDDIwEKVD-- 268  

                   dALAketqWFGp.......GSRIIVTTeDkqLLkaHgInhtIYeVgfPSk
                     LA      G +++++++G     TT  ++     g++h   eV   + 
  gi|6633842   269 --LAE----IGVpdprtkkGRKLAFTTRSQEVCARMGVEHP-MEVQ--CL 309  

                   ee..ALqIFCrsAFgQnsPp..dGFeeLeAreVtkLaGnLPLGLrVlGSs
                   ee+ A+  F +   gQ++  ++ G  +L Ar V+k +  LPL+L+V G  
  gi|6633842   310 EEnvAFDLF-QKKVGQTTLGsdPGIPQL-ARIVAKKCCGLPLALNVIGET 357  

                   LR.GkskeeWedmLpRLrtsfg...nsLDgkIekvLrvsYDgLhek.Dqa
                   +   ++ +eW  +++ L + +  + ++  +k+   L+ sYD L  ++ ++
  gi|6633842   358 MScKRTIQEWRHAIHVLNS-YAaefIGMEDKVLPLLKYSYDNLKGEqVKS 406  

                   LFLhIACfFNgekv...dyVkalLadsnnLDVrqGLkvLadK......SL
                     L+ A      k+ ++d+++ ++ +    D + G +   dK+ +  ++L
  gi|6633842   407 SLLYCALYPEDAKIlkeDLIEHWICEE-IIDGSEGIEKAEDKgyeiigCL 455  

                   Ihisplgned.kv.dgtieMHnLLqqLGReAIVrkQsidhdePgKRqFL.
                   ++ s l ++d+  + + + MH+  ++++   I  + + +     K  F  
  gi|6633842   456 VRASLLMEWDdGDgRRAVCMHDVVREMALW-I--ASELG---IQKEAFIv 499  

                   ...vDaeeIcdVLtdnTGtgtrsVlGIslDtseieeelnIsekAFegMrN
                   + +v  +eI  + + n   +          +s +e++++    + e M  
  gi|6633842   500 ragVGVREIPKIKNWNVVRR----------MSLMENKIHHLVGSYECMEL 539  

                   LqFLriykksfrddgk<-*
                      L  ++ + +   +   
  gi|6633842   540 TTLLLGKREYGSIRSQ    555  

gi|5817351|gb|AAD52719.1|AF123703_1: domain 1 of 1, from 1 to 157: score -202.3, E = 0.032
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                                  A A
  gi|5817351     1    -----------------------L--------------------ATA 4    

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L+ ++S     ++F   +F++ ++++y                +++    
  gi|5817351     5 LYARIS-----NQFDACCFIDDVSKIY---------------GDHG---P 31   

                   LhLQeqfLSkILnqkDikIhdHL....GvieERLkdqKVLIiLDDVDdle
                      Q+q+  + Ln ++++I+ +L+  +  i+ RL   K L++LD VD +e
  gi|5817351    32 IGVQKQLVRQTLNEDNLQIC-NLpmasNLIRTRLSRIKSLVVLDNVDEVE 80   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   QLd L  + +W G GSRII++  + ++L  Hg++  +Y V +  ++ ALq
  gi|5817351    81 QLDKLDMKREWLGKGSRIIIISRNGHILTEHGVDE-VYRVRLLDRKCALQ 129  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    FC+ AF+ +    G+  L                               
  gi|5817351   130 LFCQKAFKSDDIMSGYIYL------------------------------- 148  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                           t                                         
  gi|5817351   149 --------T----------------------------------------- 149  

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                      ++ La                                          
  gi|5817351   150 ---EEVLA----------------------Y------------------- 155  

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                        A                                            
  gi|5817351   156 -----A-------------------------------------------- 156  

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                       +   
  gi|5817351   157 ------------------------------------N    157  

gi|4680207|gb|AAD27570.1|AF114171_11: domain 1 of 1, from 561 to 938: score -203.0, E = 0.034
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         ++lVGi     +   L +    ++V+ V I G  G GKTTIA  
  gi|4680207   561    AELGGLVGISVPRDEVIKLVDDGA-QGVKVVSIVGCGGLGKTTIANQ 606  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    +  +      ++F   aF++ l                    + +  m 
  gi|4680207   607 VYINIA-----EKFDCQAFVS-LT------------------QNPD--MV 630  

                   LhLQeqfLSkILnq.............kDikIhdHLGvieERLkdqKVLI
                      Q      IL q ++++ +++++ +k + I+  L   ++ Lkd+    
  gi|4680207   631 IIFQS-----ILTQvkkdecdstsscdKELLIS-EL---RDFLKDK---- 667  

                   iLDDVDdleQLdALAketqWFGpGSRIIVTTeDkqLLkaHgI......nh
                                           SRIIVTT    +     I +++ +++
  gi|4680207   668 ------------------------SRIIVTT---RIGTVAKIcsspfhDL 690  

                   tIYeVgfPSkeeALqIFCrsAFg.QnsPpdGFeeLeAreVtkLaGnLPLG
                    + +    S+++    F r  Fg+++  p+  ++  ++e++k +G LPL+
  gi|4680207   691 -VFKLRMLSEDDSKRLFFRRIFGsEDKCPHQLKDV-SVEIIKKCGGLPLA 738  

                   LrVlGSsLRGks..keeWedmLp....RLrtsfgnsLDgkIekvLrvsYD
                      + S L  ks++  +W ++  + + RL++   n+  ++   +L  sY+
  gi|4680207   739 IITMASLLTTKSdtRADWLKICNsigcRLEK---NCDVEEMNMILSLSYN 785  

                   gLhekDqaLFLhIACfFN.gek..vdyVkalLadsnnLDV..........
                    L ++ +   L+   f  ++ ++++ +V  + a+  +   +++++ ++++
  gi|4680207   786 HLPHHLKTCLLYLSMFPEdYVIkrDYLVRRWVAEG-FISAhgrknledeg 834  

                   rqGLkvLadKSLIhisplgned.kvdgtieMHnLLqqLGReAIVrkQsid
                   +  ++ L ++SLI+  +  ++d++   t++ H+    L    I +k    
  gi|4680207   835 ECYFNELINRSLIQPVDF-QYDgR-VYTCRVHDVILDL----ITCKAV-- 876  

                   hdePgKRqFLvDaeeIcdVLtdnTG....tgtrsVlGIslDtseieeeln
                                e    V t+++   ++ g  +V   sl+ +++e +l 
  gi|4680207   877 ------------EENFVTVVTNGKQmlpsHG--KVHRLSLEYHGLE-TLR 911  

                   IsekAFegMrNLqFLriykksfrddgk<-*
                    +  +    r L   r  + +   +g    
  gi|4680207   912 TNPIVTTHVRSLDIFRYSEEMLPLSGF    938  

gi|5231014|gb|AAD41050.1|AF122982_1: domain 1 of 1, from 165 to 587: score -203.0, E = 0.034
                   *->rDFddlVGiEaHlekmksLLcLds.kdeVrMVGIwGPaGIGKTTIAR
                         + lVGi+a   k k++ +L s++ ++  V + G  G GKTT   
  gi|5231014   165    ---NSLVGIDA--PKGKLIGRLLSpEPQRIVVAVVGMGGSGKTT--- 203  

                   ALfsqLSerhFq.ssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyG
                    L   +++++  ++ F+  a ++ +++sy   ei        ++ e +  
  gi|5231014   204 -LSANIFKSQSVrRHFECYAWVT-ISKSY---EIED--VFRTMIKEFY-- 244  

                   mKLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQL
                        + q  +++      +  +    + E L+ ++  ++LDDV    + 
  gi|5231014   245 --KEAETQIPAELYSLGYRELVE---KLVEYLQSKRYIVVLDDVWTTGLW 289  

                   d....ALAketqWFGpGSRIIVTTeDkqLLka.HgInhtIYeVgfPSkee
                    + + AL + +    +GSR+  TT D      ++gI  t  e ++  ++e
  gi|5231014   290 ReisiALPDGI----YGSRVMMTTRDMNVASFpYGIGSTKHEIELLKEDE 335  

                   ALqIFCrsAFgQnsPpdGFeeL..eAreVtkLaGnLPLGLrVlGSsLR.G
                   A   F   AF  +  +   ++L++ Ar+  +++  LPL+   lGS + + 
  gi|5231014   336 AWVLFSNKAFPGSLEQCRTQNLepIARKLLERCQGLPLAIASLGSMMStK 385  

                   kskeeWedmLpRLrtsfgnsLDgkI.ekvLrvsYDgLhekDqaLFLhIAC
                   k + eW+++   L  ++ n L  kI  ++L  s+++L    +  FL+   
  gi|5231014   386 KFESEWKKVYSTLNWELNNNLELKIvRSILLLSFNDLPYPLKRCFLYCSL 435  

                   f...FN.gekvdyVkalLadsnnLDVrqG..........LkvLadKSLIh
                   f+ + + ++k  +V  + a   ++    G + ++  ++ L+ L+++   +
  gi|5231014   436 FpvnYRmKRK-RLVRMWMAQR-FVEPIRGvkaeevadsyLNELVYRNMLQ 483  

                   isplgnedkvdgtieMHnLLqqLGReAIVrk..................Q
                   +  ++   +  +  +MH+   + +    V k ++  +  ++++++++  +
  gi|5231014   484 VILWNPFGR-PKAFKMHDVIWEIALS--VSKlerfcdvynddsdgddaaE 530  

                   sidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtseieeelnI
                    i  +++g R+  +  e      t ++              +++   l +
  gi|5231014   531 TI--ENYGSRHLCIQKE-----MTPDSIRA-----------TNLH-SLLV 561  

                   sekAFegMrNLqFLriykksfrddgk<-*
                     +A  +M  L  L+  + ++  d     
  gi|5231014   562 CSSAKHKMDLLPSLKLLRALDLEDSA    587  

gi|13487349|gb|AAK27506.1|: domain 1 of 1, from 189 to 557: score -203.7, E = 0.037
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrM.....VGIwGPaGIGKT
                      rD d +V         + LL      e+   + ++  I G  G GK+
  gi|1348734   189    RDRDRIV---------DFLLGKTTTAEASSakysgLAIVGLGGMGKS 226  

                   TIARALfs..qLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglD
                   T A   ++++++      + F  +  +  +r                 lD
  gi|1348734   227 TLAQYVYNdkRIE-----ECFDIRMWVCISR----------------KLD 255  

                   eYsyGmKLhLQeqfLSkIL..nqkDi..kIhdHLGvieERLkd.....qK
                    +        + +   +I+++ +k+  ++++ +L +++  L+d  +++qK
  gi|1348734   256 VHR-------HTR---EIIesAKKGEcpRVD-NLDTLQCKLRDilqesQK 294  

                   VLIiLDDV......Ddle...QLdALAketqWFGpGSRIIVTTeDkqLLk
                    L++LDDV  +++++  e + +L  L+ +     +GS + VT   k L  
  gi|1348734   295 FLLVLDDVwfekshNETEwelFLAPLVSKQ----SGSKVLVTSRSKTLPA 340  

                   a......HgInhtIYeVgfPSkeeALqIFCrsAFgQnsPpdGFe..eL..
                   a   +++H I ++    +   + e L  F  +AF     +d   +++L++
  gi|1348734   341 AicceqeHVIHLE--NMD---DTEFLALFKHHAFSGAEIKDQLLrtKLed 385  

                   eAreVtkLaGnLPLGLrVlGSsLRG.kskeeWedmLpRLrtsfgnsLDgk
                    A+e++k+ G  PL+ +VlGS L ++k+  eW+ +L  L        D  
  gi|1348734   386 TAEEIAKRLGQCPLAAKVLGSRLCRkKDIAEWKAALK-LGD----LSDPF 430  

                   IekvLrvsYDgLhekDqaLFLhIACfFN.gekv..dyVkalLadsnnLDV
                       L  sY++L  + q  FL+   f  +++ +++ +V+ + a+      
  gi|1348734   431 --TSLLWSYEKLEPRLQRCFLYCSLFPKgHRYDpnQLVHLWVAEG----- 473  

                   rqGLkvLadKSLIhisplgne..........dkvdgtieMHnLLqqLGRe
                    +G ++L  + L    +  ++ ++  +++  +   ++ +MH+ L  ++ e
  gi|1348734   474 FVGSCNLSRRTLEEAGM--DYfndmvsgsffQWYGRYYVMHDILHDFA-E 520  

                   AIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtsei
                         s              ++e c  L d+  t+             i
  gi|1348734   521 ------SL-------------SREDCFRLKDDNVTE-------------I 538  

                   eeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                 +  + L+++  s +++++   
  gi|1348734   539 P-------------CTVRHLSVHVQSMQKHKQ    557  

gi|7489351|pir||T30563: domain 1 of 1, from 152 to 484: score -204.0, E = 0.038
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      +DF          +  + L  L+      M+  +G  G+GKT     
  gi|7489351   152    NDFQ-----SREVRFSEALKALEAN---HMIALCGMGGVGKTHMMQR 190  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L          ++  +  ++e + g     ei     +   + +Y   + 
  gi|7489351   191 LKKVAK-----EKRKFGYIIEAVIG-----EISDPIAIQQVVADY---LC 227  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdq......KVLIiLDDVDd
                     L e         k  + +  L   ++  k +++++++K LIiLDDV +
  gi|7489351   228 IELKES-------DKKTRAE-KL---RQGFKAKsdggntKFLIILDDVWQ 266  

                   leQLdAL.....AketqWFGpGSRIIVTTeDkqLLkaHgInht.IYeVgf
                   ++ L+ ++ +++ ++    G    +  T  D +     g++ ++I  Vg+
  gi|7489351   267 SVDLEDIglspsPNQ----GVDFKVLLTSRDEHVCSVMGVEANsIINVGL 312  

                   PSkeeALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsL
                     + eA   F +  F ++s p+   ++  + +++++  LP + + +   L
  gi|7489351   313 LIEAEAQRLFQQ--FVETSEPEL-HKI-GEDIVRRCCGLPIAIKTMACTL 358  

                   RGkskeeWedmLpRLrtsfgnsLDgkIe.kvLrvsYDgLhek.DqaLFLh
                   R k k+ W+d+L RL+     +  g++ + v r sY+ L +k+ ++ FL 
  gi|7489351   359 RNKRKDAWKDALSRLQH----HDIGNVAtAVFRTSYENLPDKeTKSVFLM 404  

                   IACf...FNgekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgned
                      f+++FN  +    ++l           GLk        ++ +     
  gi|7489351   405 CGLFpedFNIPT----EELMRYG------WGLKLFD-----RVYT----- 434  

                   kvdgtieMHnLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdn
                                      I     i               e ++ L+ +
  gi|7489351   435 -------------------I-----I---------------EARNRLNTC 445  

                   TGtgtrsVlGIslDtseieeelnIsekAFegMrNLqFLriykksfrddgk
                   ++            +  +   +  +  +  +M++L    +   ++  ++ 
  gi|7489351   446 IDRL----------VQTNL-LIGSDNGVHVKMHDLVRAFVLGMYSEVEQA 484  

                   <-*
                      
  gi|7489351     -     -    

gi|8118185|gb|AAF72928.1|: domain 1 of 1, from 1 to 157: score -204.3, E = 0.04
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                                  A A
  gi|8118185     1    -----------------------L--------------------ATA 4    

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L++++S     ++F   + ++ ++++y          r+   D       
  gi|8118185     5 LYNKIS-----HQFSVYCLIDDVSKIY----------RH---DGP----- 31   

                   LhLQeqfLSkILnqkDikIhdHL....GvieERLkdqKVLIiLDDVDdle
                    + Q+q L + L+ ++++ + +L + +  i+ RL++ K LIiLD VD++e
  gi|8118185    32 MSAQRQILCQTLGEEHLQMC-NLynasNLIRSRLRHVKSLIILDNVDHVE 80   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   QL+ LA   +W G GSRII+TT D ++Lk +g++  +Y+V +  +   Lq
  gi|8118185    81 QLEKLAVSREWLGAGSRIIITTRDEHILKVYGVDV-VYKVPLLNNTNSLQ 129  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    F + AF+ +    G+ +L                               
  gi|8118185   130 LFSQKAFKLDHIISGYDKL------------------------------- 148  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                                                                     
  gi|8118185     - -------------------------------------------------- -    

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                                                                     
  gi|8118185     - -------------------------------------------------- -    

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                        A                                            
  gi|8118185   149 -----A-------------------------------------------- 149  

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                           ++I                      +  +   
  gi|8118185   150 --------FDI---------------------LSYAN    157  

gi|7489509|pir||T02226: domain 1 of 1, from 1 to 354: score -204.6, E = 0.042
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                +            GKTT A  
  gi|7489509     1    -------------------------GGW-----------GKTTLAQK 11   

                   Lfs..qLSerhFqssFqlsa.FmenlrgsyskeeigSgetrpaglDeYsy
                    f++++L       +F ++a+F++                    + eYs 
  gi|7489509    12 IFNdkKLE-----GRFDHRAgFVS--------------------PREYS- 35   

                   GmKLhLQeqfLSkILnqkDikIh....dHLGvieERLk....dqKVLIiL
                            +L+++L   ++kIh ++++  G ++  Lk +  d+  +++L
  gi|7489509    36 ------MVSLLAQVLS--NMKIHyeknESVGNLQSKLKagiaDKSFFLVL 77   

                   DDVDdleQ........LdALAketqWFGpGSRIIVTTeDkqLLkaHgInh
                   DDV + +  ++  +++L A A      G    I VTT D  + +  g++ 
  gi|7489509    78 DDVWHYKAwedllrtpLNAAAT-----GI---ILVTTRDETIARVIGVDR 119  

                   tIYeVgfPSkeeALqIFCrsAFgQnsPp.dGFeeLeAreVtkLaGnLPLG
                   t   V++ S +   + + rs   +   +     +    e+++ +G LPL+
  gi|7489509   120 T-HRVDLMSADIGWELLWRSMNIKEEKQvKNLRDT-GIEIVRKCGGLPLA 167  

                   Lr...VlGSsLRGkskeeWedmL.......pRLrtsfgnsLDgkIekvLr
                    r    +  sL   +++eW  +L+++  +   L       L+g     L 
  gi|7489509   168 IRaiaKVLASLQDQTENEWRQILgknawsmSKLPD----ELNG----ALY 209  

                   vsYDgLhekDqaLFLhIACfFN..gekvdyVkalLadsnnLDVrqG..Lk
                    sY+ L ++ +  FL+ A f  +    + +++ +  + ++ D + G+ L+
  gi|7489509   210 LSYEVLPHQLKQCFLYCALFPEdaTIFCGDLTRMWVAEGFIDEQEGqlLE 259  

                   vLadKS...LIhisplgned.kv.dgtieMHnLLqqLGReAIVrkQsidh
                     a++  ++LIh + l+ +    +  +++MH+LL+qL+     r+++   
  gi|7489509   260 DTAERYyheLIHRNLLQPDGlYFdHSRCKMHDLLRQLASY-LSREEC--- 305  

                   dePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtseieeelnIsek.
                          F  D+e     L  nT  +          +++i+   ++ ek+
  gi|7489509   306 -------FVGDPE----SLGTNTMCK----------VRRIS---VVTEKd 331  

                   ..AFegMrNLqFLriykksfrddgk<-*
                     ++  M   q+ ++ +  + ++gk   
  gi|7489509   332 ivVLPSMDKDQY-KVRCF-TNFSGK    354  

gi|11357253|pir||T48898: domain 1 of 1, from 160 to 589: score -204.9, E = 0.043
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIAR.
                          dlVG E   +++   L  ++ d    V I G  GIGKTT AR+
  gi|1135725   160    SSESDLVGVEQSVKELVGHL-VEN-DVHQVVSIAGMGGIGKTTLARq 204  

                   .ALfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyG
                    + +++       + F   a +  +                       + 
  gi|1135725   205 vFHHDLVR-----RHFDGFAWVCVSQQ---------------------FT 228  

                   mKLhLQeqfL......SkILnqkDikIhdHLGvieERLkdqKVLIiLDDV
                    K  +Q+ + + ++++  IL ++          + + L   K L++LDDV
  gi|1135725   229 QKHVWQRILQelqphdGDILQMDEYALQ---RKLFQLLEAGKYLVVLDDV 275  

                   ...DdleQLdA...........LAketqWFGpGSRIIVTTeDkqLL...k
                    +++d ++ +A  +++++ +  L    +  G        T    +L++++
  gi|1135725   276 wkkEDWDVIKAvfprkrgwkmlLTSRNEGVGIHADPTCLTFRASILnpeE 325  

                   aHgInhtIYeVgfPSkeeALqIFCrsAFgQnsPpdGFeeLeAreVtkLaG
                   +           fP ++e           +    +  e    +e ++++G
  gi|1135725   326 SWKLCER---IVFPRRDE----------TEVRLDEEMEAM-GKEMVTHCG 361  

                   nLPLGLrVlGSsLR.GkskeeWedmLpRLrtsf..gnsLDgk....Iekv
                    LPL+ +VlG  L +  +  eW+++   + + + +g +LD+++ +++  +
  gi|1135725   362 GLPLAVKVLGGLLAnKHTVPEWKRVSDNIGSQIvgGSCLDDNslnsVYRI 411  

                   LrvsYDgLhekDqaLFLhIA...........CfFNgekvdyVka..lLad
                   L  sY++L  + +  FL  A+ ++ ++ +   +FN+  v+ + +++ + d
  gi|1135725   412 LSLSYEDLPTHLKHRFLFLAhfpeyskisayDLFNYWAVEGIYDgsTIQD 461  

                   snnLDVrqGLkvLadKSLIhisplgned.kvdgtieMHnLLqqLGReAIV
                   s+    ++ L+ L+ + L+ i +++   ++  + + MH++     Re ++
  gi|1135725   462 SG----EYYLEELVRRNLV-IADNRYLSsH-SKNCQMHDMM----RE-VC 500  

                   rk......................QsidhdePgKRqFLvDaeeIcdVLtd
                     + ++++  +  ++++++++ + Qs      + R+  + +      L +
  gi|1135725   501 LSkakeenflqiikdptststinaQSP----SRSRRLSIHSGKAFHLLGH 546  

                   nTGtgtrsVlGIslDtseieeelnIsekAFegMrNLqFLriykksfrddg
                   +  t+ rs +     ++  +   + s ++F  ++ L+ L  y  + +++g
  gi|1135725   547 KNNTKVRSLI-----VWDED-FGIRSASVFHNLTLLRVLDLY--WVKFEG 588  

                   k<-*
                       
  gi|1135725   589 G    589  

gi|7489354|pir||T30564: domain 1 of 1, from 148 to 539: score -205.4, E = 0.045
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         dd+   E   +  + L  L+  ++  MV  +G  G+GKT   R 
  gi|7489354   148    SSSDDFPSREK--TFTQALKALEPNQQFHMVALCGMGGVGKT---RM 189  

                   Lf........sqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpagl
                   + + ++  ++ +L+      +++ +a ++ +       + +    +   +
  gi|7489354   190 MQrlkkaaeeKKLF------NYIVRAVIGEKT------DPFA---IQEAI 224  

                   DeYsyGmKLhLQeqfLSkILnqkDikIhdHLGvieERLk......dqKVL
                    +Y   +  +L e+        k  + +  L   +E+ k++++++  K L
  gi|7489354   225 ADY---LGIQLNEK-------TKPARAD-KL---REWFKknsdggKTKFL 260  

                   IiLDDVDdleQLdALAketqWF...GpGSRIIVTTeDkqLLkaHgInht.
                   I+LDDV +l+ L+ +    + F+++G    +  T  D q     g++ ++
  gi|7489354   261 IVLDDVWQLVDLEDIGL--SPFpnqGVDFKVLLTSRDSQVCTMMGVEANs 308  

                   IYeVgfPSkeeALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLr
                   I  Vg+ ++ eA   F +  F ++s p+  +++  + +++ +  LP + +
  gi|7489354   309 IINVGLLTEAEAQSLFQQ--FVETSEPEL-QKI-GEDIVRKCCGLPIAIK 354  

                   VlGSsLRGkskeeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhek.Dq
                    +   LR k k+ W+d+L R++      ++    kv   sY  L e++ +
  gi|7489354   355 TMACTLRNKRKDAWKDALSRIEH---YDIHNVAPKVFETSYHNLQEEeTK 401  

                   aLFLhIACfFNgekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgn
                   + FL    f   ++    ++l           GLk       I+  +++ 
  gi|7489354   402 STFLMCGLFPEDFD-IPTEELMRYG------WGLKLFDRVYTIREARTRL 444  

                   e...............dkvdgtieMHnLLq..qLGR..eAIVrkQsidhd
                   ++  ++  +++   ++d+  g+++MH+L +   LG  +e  V + si   
  gi|7489354   445 NtcierlvqtnlliesDD-VGCVKMHDLVRafVLGMfsE--VEHASI--- 488  

                   ePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtseieeelnIsekAF
                           v+     +  ++++ ++            +i+   + s + F
  gi|7489354   489 --------VNHGNMPEWTENDITDS----------CKRIS-LTCKSMSKF 519  

                   eg...MrNLqFLriykksfrddgk<-*
                    g+ + +NL  L+        d+    
  gi|7489354   520 PGdfkFPNLMILKLMHG----DKS    539  

gi|9758140|dbj|BAB08632.1|: domain 1 of 1, from 168 to 546: score -205.4, E = 0.046
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIA..
                           +VG++  l ++k  L Ld    V    ++ P+G GKTT  ++
  gi|9758140   168    -----IVGLDWPLGELKKRL-LDD-SVV-TLVVSAPPGCGKTTLVsr 206  

                   ............RALfsqLSerhFqssFqlsaFmenlrgsyskeeigSge
                     ++++ +++ + + f+  S     +   +++++ nl             
  gi|9758140   207 lcddpdikgkfkHIFFNVVS-----NTPNFRVIVQNLL------------ 239  

                   trpaglDeYsyGmKLhLQeqfLSkILnqkDikIhdHLGvieERLkdq.KV
                        ++ Y+              ++  +D + +  L  + E Lk  +  
  gi|9758140   240 ----QHNGYN-------------ALTFENDSQAEVGLRKLLEELKENgPI 272  

                   LIiLDDVDdleQLdALAketqWFGpGSRIIVTTeDkqLLkaHgInh.tIY
                   L++LDDV              W G  S          +L+ + I++++ Y
  gi|9758140   273 LLVLDDV--------------WRGADS----------FLQKFQIKLpN-Y 297  

                   eV......gfPS...........keeALqIFCrsAFg.QnsPpdGFeeLe
                   +   +++ +fPS +++ + ++ ++++A   +   A ++ n+ pd +e+L 
  gi|9758140   298 KIlvtsrfDFPSfdsnyrlkpleDDDARALLIHWASRpCNTSPDEYEDL- 346  

                   AreVtkLaGnLPLGLrVlGSsLRGkskeeWedmLpRLrtsfgnsLDgk..
                    +++ k++  +P    V+G sL+G+s + W+ +        g+ + gk+ 
  gi|9758140   347 LQKILKRCNGFPIVIEVVGVSLKGRSLNTWKGQVESWSE--GEKILGKpy 394  

                   ..IekvLrvsYDgLhekDqaLFLhIACfFN.gekvdyVk.....alLads
                   +++ + L+ s+D+L+ + ++ FL    f  +++++  V  +   +l ++ 
  gi|9758140   395 ptVLECLQPSFDALDPNLKECFLDMGSFLEdQKIRASVIidmwvELYGKG 444  

                   nnLDVrqGLkvLadKSLIhisplgned.k...v.dgtieMHnLLqqLGRe
                    +      L+ La   L +  plg+++++++  +d  +  H+ L++L+  
  gi|9758140   445 -SSILYMYLEDLASQNLLKLVPLGTNEhEdgfYnDFLVTQHDILRELA-- 491  

                   AIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtsei
                    I++ + +   e  +R+ L       ++L++   +         l+t + 
  gi|9758140   492 -ICQSEFK---ENLERKRLN-----LEILENTFPDW-------CLNTINA 525  

                   eeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   +  l+Is + +          +  k+   d +   
  gi|9758140   526 S-LLSISTDDL----------FSSKWLEMDCP    546  

gi|6606266|gb|AAF19148.1|AF158634_1: domain 1 of 1, from 172 to 599: score -205.6, E = 0.046
                   *->rDFddlVGiEaHlekmksLL....cLdskdeVrMVGIwGPaGIGKTT
                             G    l  + ++L +++  +   + + V I G  G GKTT
  gi|6606266   172    QGGHKVFGRNKELNDIVQMLveppSPHC-TACKVVSIVGFGGLGKTT 217  

                   IARALfs..qLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDe
                    A   +++ +       s F l+a  + ++                    
  gi|6606266   218 LAQSVYDdlRVK-----SHFDLRAWAY-VS------------------GK 243  

                   YsyGmKLhLQeqfLSkI.......LnqkDikIhdHLGvieERLk.dqKVL
                    +   K  L +q L   +++ +++++ kD      L    +RL++ ++ L
  gi|6606266   244 PD---KVELAKQILRSAnpryggsID-KDATFA-TLQLKLNRLMsSKRFL 288  

                   IiLDDV..Ddl.......eQLdALAketqWFGpGSRIIVTTeDkqLLkaH
                   I+LDD+ +Dd  +++  +e L  L   ++   +GSRII +T+  +     
  gi|6606266   289 IVLDDIwgDDPftneaynEILSPLRS-ME---SGSRIIAVTQTPKVAGML 334  

                   gInhtIYeVgfPSkeeALqIFCrsAFgQnsPpdG....FeeLeAreVtkL
                   +  ht Y       ++       sA g  s ++ ++++ e++  r+++  
  gi|6606266   335 DASHT-YYLNALGADDCWSLIKESALGGWSTHEEstqeLEQI-GRKIAAK 382  

                   aGnLPLGLrVlGSsLR.GkskeeWedmLpRLrtsfgnsLDgkI.ekvLrv
                      LPL+ + +G  L   ks ++W  +    ++       g+I+ + Lr 
  gi|6606266   383 LNGLPLAAKLMGGLLGaTKSTKYWRIIS---EK----EFSGDItLSLLRL 425  

                   sYDgLhekDqaLFLhIACfFNgekvd...yVkalLadsnnLDVrqG....
                   sY  L  + +  F    +f    k d++++V  + a+  +   + G++++
  gi|6606266   426 SYSYLPGRLKQCFAFCSIFPKNWKFDqtnLVRLWMANG-FIQPQSGtgkr 474  

                   ........LkvLadKSLIhisplgnedkvdgtieMHnLLqqLGReAIVrk
                    ++ +++ ++ L  +S  h  + g+      + +MH+L   ++  A   +
  gi|6606266   475 medlgtdyFNLLLSRSFFHALRQGR----RTHYKMHDLIHDMAVSA-STE 519  

                   QsidhdePg.KRqF.............LvDaeeIcdVLtdnTGtgtrsVl
                    +  + ePg  R+++++ ++ + ++++L D +    +L  n  t    V 
  gi|6606266   520 DCC-QIEPGmTRRIpstvrhvsvttgsLQDVNAAIKILPKNLRTF--IVF 566  

                   GIslDtseiee.elnIsekAFegMrNLqFLriykksfrddgk<-*
                   G         +   + +++++ ++ NL+ L +  + f   ++   
  gi|6606266   567 G---------NwPHFLEDDSLGKLKNLRALDVCHCDFTELPP    599  

gi|12744963|gb|AAK06861.1|: domain 1 of 1, from 190 to 556: score -206.2, E = 0.05
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrM.....VGIwGPaGIGKT
                      rD           +  k LL      e+  ++ ++  I G  G GK+
  gi|1274496   190    RD-----------RIVKFLLGKTTTAEASStkysgLAIVGLGGMGKS 225  

                   TIARALfs..qLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglD
                   T A   ++++++      + F  ++ +  +r                 lD
  gi|1274496   226 TLAQYVYNdkRIE-----ECFDVRIWICISR----------------KLD 254  

                   eYsyGmKLhLQeqfLSkIL..nqkDi..kIhdHLGvieERLkd.....qK
                    +        + +   +I+++ +k+  ++++ +L +++  L+d  +++qK
  gi|1274496   255 VHR-------HTR---EIIesAKKGEcpRVD-NLDTLQCKLRDilqesQK 293  

                   VLIiLDDV......Ddle...QLdALAketqWFGpGSRIIVTTeDkqLLk
                    L++LDDV  +++++  e + +L  L+ +     +GS + VT     L  
  gi|1274496   294 FLLVLDDVwfekshNETEwelFLAPLVSKQ----SGSKVLVTSRSETLPA 339  

                   a......HgInhtIYeVgfPSkeeALqIFCrsAFgQnsPpdGF..eeL..
                   a   +++H I ++    +   + e L  F  +AF     +d   +++L++
  gi|1274496   340 AicceqeHVIHLE--NMD---DTEFLALFKHHAFSGAEIKDQLlrMKLqd 384  

                   eAreVtkLaGnLPLGLrVlGSsL.RGkskeeWedmLpRLrtsfgnsLDgk
                    A+e++k+ G  PL+ +VlGS + R+k+  eW+ +L  L        D  
  gi|1274496   385 TAEEIAKRLGQCPLAAKVLGSRMcRRKDIAEWKAALK-LGD----LSDPF 429  

                   IekvLrvsYDgLhekDqaLFLhIACf..FN.gekvdyVkalLadsnnLDV
                       L  sY++L+   q  FL+   f++ ++++  ++V+ + a+      
  gi|1274496   430 --TSLLWSYEKLDPCLQRCFLYCSLFpkGHgYRPEELVHLWVAEG----- 472  

                   rqGLkvLadKSL...........IhisplgnedkvdgtieMHnLLqqLGR
                    +G ++L  + L++ + +  ++ +++s  +++     + +MH+ L  ++ 
  gi|1274496   473 FIGSCNLSRRTLeevgmdyfndmVSVSFFQRY---GWYYVMHDILHDFA- 518  

                   eAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtse
                   e      s              ++e c  L+d+  t+             
  gi|1274496   519 E------SL-------------SREDCFRLEDDNVTE------------- 536  

                   ieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                   i              +  + L++   s +++++   
  gi|1274496   537 IP-------------CTVRHLSVRVESMQKHKE    556  

gi|1931650|gb|AAB65485.1|: domain 1 of 1, from 135 to 498: score -206.4, E = 0.051
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIAR.
                          dlVG E   e++   L  ++ d    V I+G  GIGKTT AR+
  gi|1931650   135    SSESDLVGVEQSVEALAGHL-VEN-DNIQVVSISGMGGIGKTTLARq 179  

                   .ALfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyG
                    + ++    rhF + F   +F++              +  +     +   
  gi|1931650   180 vFHHDMVQ-RHF-DGFAW-VFVS--------------QQFT---QKHV-- 207  

                   mKLhLQeqfLSkILnqkDikIhdHL......GvieERLkdqKVLIiLDDV
                   ++  +Qe      L  ++  I+ H +++  +G +   L   + L++LDDV
  gi|1931650   208 WQRIWQE------LQPQNGDIS-HMdehilqGKLFKLLETGRYLVVLDDV 250  

                   ......DdleQLdALAketqW...................FGpGSRIIVT
                    ++++ D ++   +   +  W+   ++++++ + + ++++FG   RI   
  gi|1931650   251 wkeedwDRIK--AVFPRKRGWkmlltsrnegvgihadpksFGFKTRILTP 298  

                   TeDkqLLkaHgInhtIYeVgfPSkeeALqIFCrsAFgQnsPpdGFeeLeA
                    e  +L +                             ++    + e    
  gi|1931650   299 EESWKLCEKIVFHRR---------------------DETGTLSDMEAM-G 326  

                   reVtkLaGnLPLGLrVlGSsLR.GkskeeWedmLpRL......rtsfgns
                   +e ++ +G LPL+ +VlG  L +  +  eW+++   ++++  +r+    s
  gi|1931650   327 KEMVTCCGGLPLAVKVLGGLLAtKHTVPEWKRVYDNIgphlagRS----S 372  

                   LDgk...IekvLrvsYDgLhekDqaLFLhIACfFN.gekvdyVkalLads
                   LD++ ++I  vL  sY+ L    +  FL+ A f   +e+  +Vk l    
  gi|1931650   373 LDDNlnsIYRVLSLSYENLPMCLKHCFLYLAHFPEyYEI--HVKRLFN-- 418  

                   nnLDVrqGLkvLadKSLIhisplgnedkvdgtieMH..nLLqqLGReAIV
                              La   +I  s+ g+      ti   +++ L++L+R    
  gi|1931650   419 ----------YLAAEGIITSSDDGT------TIQDKgeDYLEELARR--- 449  

                   rkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtseieee
                       +         + +D +   + +  ++  +          ++ + +e
  gi|1931650   450 ----N--------MITIDKN---YMFLRKKHCQ----------MHDMMRE 474  

                   lnIsekAFegMrNLqFLriykksfrddgk<-*
                   ++ s+   e      FL+i+k s+  +     
  gi|1931650   475 VCLSKAKEEN-----FLEIFKVSTATSAI    498  

gi|3075464|gb|AAC14553.1|: domain 1 of 1, from 1 to 155: score -207.7, E = 0.06
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                                  A++
  gi|3075464     1    -----------------------L--------------------AKV 4    

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    f+ +S     + F+ s F en r+       +S     + +  +     
  gi|3075464     5 AFNEFS-----HLFEGSSFLENFRE-------YS-----KKPEGRT---- 33   

                   LhLQeqfLSkILnqkDikIhdHLG.vieERLkdqKVLIiLDDVDdleQLd
                    hLQ q+LS IL+ +Di+    L ++++ER + ++V ++ DDVDd+ QL 
  gi|3075464    34 -HLQHQLLSDILRRNDIEFK-GLDhAVKERFRSKRVPLVVDDVDDVHQLN 81   

                   ALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIY...eVgfPSkeeALq
                     A +  +FG+GSRII+TT + +LLk+ + +   Y+++e +    +e L+
  gi|3075464    82 SAAIDRDCFGHGSRIIITTRNMHLLKQLRAEGS-YspkELD---GDESLE 127  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    F  +AF+ + Pp  F +  ++eV++ +                      
  gi|3075464   128 LFSWHAFRTSEPPKEFLQH-SEEVVTYC---------------------- 154  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                                                                     
  gi|3075464     - -------------------------------------------------- -    

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                                                                     
  gi|3075464     - -------------------------------------------------- -    

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                        A                                            
  gi|3075464   155 -----A-------------------------------------------- 155  

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                           
  gi|3075464     - -------------------------------------    -    

gi|8118154|gb|AAF72916.1|: domain 1 of 1, from 1 to 157: score -208.6, E = 0.067
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                                  A A
  gi|8118154     1    -----------------------L--------------------ATA 4    

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L++++S     ++F   + ++ ++++y          r+   D       
  gi|8118154     5 LYNKIS-----HQFSVYCLIDDVSKIY----------RH---DGP----- 31   

                   LhLQeqfLSkILnqkDikIhdHL....GvieERLkdqKVLIiLDDVDdle
                    + Q+q L + L+ + ++ + +L + +  i+ RL++ K LIiLD VD++e
  gi|8118154    32 MSAQKQILCQTLGEELLQMC-NLynasNLIRSRLRHVKSLIILDNVDHVE 80   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   QL+ LA   +W G GSRII+TT D ++Lk +g++  +Y+V +  +   Lq
  gi|8118154    81 QLEKLAVSREWLGAGSRIIITTRDEHILKVYGVDV-VYKVPLLNNTNSLQ 129  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    F + AF+ +    G+ +L                               
  gi|8118154   130 LFSQKAFKLDHIISGYDKL------------------------------- 148  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                                                                     
  gi|8118154     - -------------------------------------------------- -    

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                                                                     
  gi|8118154     - -------------------------------------------------- -    

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                        A                                            
  gi|8118154   149 -----A-------------------------------------------- 149  

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                           ++I                      +  +   
  gi|8118154   150 --------FDI---------------------LSYAN    157  

gi|6983863|dbj|BAA90798.1|: domain 1 of 1, from 157 to 546: score -209.0, E = 0.07
                   *->rDFddlVGiEaHlekmksLLcLds..kdeVrMVGIwGPaGIGKTTIA
                       D   lVG +   +++     +d +++d  r   + G  G GKTT  
  gi|6983863   157    IDEAKLVGFDTPKKELLDKINMDAndDDHCRVLCVVGMGGLGKTTLV 203  

                   RALfs...qLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeY
                   R  f +++ +      ++F ++a +  ++      +++S    + +l + 
  gi|6983863   204 RKIFEskeDII-----NNFPHRAWIV-VS------QSFS---MIEMLKDM 238  

                   syGmKLhLQeqfLSkILnqkDikIhdHLGv.ieERLkdqKVLIiLDDV..
                      ++L  +e +  k +  k i+ h +LG+++++ Lk  + +++ DD+ +
  gi|6983863   239 I--SQLLGHESL--KRFEGKPIRAH-DLGThLRDGLKELRYFVVFDDLwn 283  

                   .DdleQLd..ALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfP
                   +D+ e   + AL  + +     SR+IVTT       a   +  +Y  ++ 
  gi|6983863   284 tDHWEWIRefALPSKNN---KRSRVIVTTRLDGVANACTTEPFVYRLKLL 330  

                   SkeeALqIFCrs..AFgQnsPp.dGFeeLeAreVtkLaGnLPLGLrVlGS
                    +e A   + r  +  +++   ++  + + + + +k +G LPL+    G 
  gi|6983863   331 ETECAIDLLLRKmgESKEDMKNdNNLKSI-VTQLVKKCGCLPLAIVTIGA 379  

                   sLRGkskeeWedmLpRLrtsfgnsLDgk.......IekvLrvsYDgLhek
                    +  k    We+m + L +     L  +++++ + I  v   sY  L ++
  gi|6983863   380 MFANKPSSKWEEMCRQLPS----ELENNpspgveaIRRVVTLSYGHLPSH 425  

                   DqaLFLhIACfFN.gek..vdyVkalLadsnnLDVrqGLkv.........
                    +  +L+  +f  + e++++++V  + a+   +  r+G ++++ +++  +
  gi|6983863   426 LKPCYLYLSIFPEdIEIkrRHLVNRWVAEG-LVRARVGMTIsdvgesyfd 474  

                   .LadKSLIhisplgnedkvdgtieMHnLLqqLGReAIVrkQsidhdePgK
                   +L  +S I+ s+ + e +  + ++ H+  +      I  k+++       
  gi|6983863   475 eLISRSMIQPSRVNMEGH-VKSCRVHDIMRDIIVS-I-SKEEN------- 514  

                   RqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtseieeelnIsekAFegMr
                                + + TG+              ++ ++++++       
  gi|6983863   515 -------------FVYSTGDN-------------VS-TVIVEK------- 530  

                   NLqFLriykksfrddgk<-*
                    ++ L+ +   +   g+   
  gi|6983863   531 -FRHLSCHGGNYPIVGM    546  

gi|8118199|gb|AAF72933.1|: domain 1 of 1, from 1 to 157: score -209.2, E = 0.072
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                                  AR+
  gi|8118199     1    -----------------------L--------------------ARI 4    

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L+ ++S     s+F   +F++ ++              +++ ++      
  gi|8118199     5 LYRRIS-----SQFDACCFIDDVS--------------KICKHD----GP 31   

                   LhLQeqfLSkILnqkDikIhdHLG....vieERLkdqKVLIiLDDVDdle
                      Q+q LS+ L+ ++++I+ +L ++ + i++RL + + +IiLD VD+ e
  gi|8118199    32 VAAQKQILSQTLGEEHLQIC-NLSdganLIQNRLGHLRAFIILDNVDQGE 80   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   QL+ LA      G GSRII++  D ++L  +g++  + +V +  +   Lq
  gi|8118199    81 QLEKLAVNLMRLGVGSRIIIISRDTHILNRYGVDV-VFKVPLLNQTNSLQ 129  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    FC+ AF+++s    +eeL+                              
  gi|8118199   130 LFCQQAFKRDSILSNYEELV------------------------------ 149  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                                                                 +e+ 
  gi|8118199   150 ----------------------------------------------YEI- 152  

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                                             L                       
  gi|8118199   153 --------------------------LNY--------------------- 155  

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                        A                                            
  gi|8118199   156 -----A-------------------------------------------- 156  

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                        +                                  
  gi|8118199   157 -----D-------------------------------    157  

gi|1361985|pir||A57072: domain 1 of 1, from 170 to 557: score -209.4, E = 0.073
                   *->rDFddlVGiEaHlekmksLLcLds.kdeVrMVGIwGPaGIGKTTIAR
                         + lVGi+a   k k++ +L s++ ++  V + G  G GKTT   
  gi|1361985   170    ---NSLVGIDA--PKGKLIGRLLSpEPQRIVVAVVGMGGSGKTT--- 208  

                   ALfsqLSerhFq.ssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyG
                    L   +++++  ++ F+  a ++ +++sy  e+++       ++ e +  
  gi|1361985   209 -LSANIFKSQSVrRHFESYAWVT-ISKSYVIEDVFR-----TMIKEFY-- 249  

                   mKLhLQeqfLSkILnqkDikIhdHL.........GvieERLkdqKVLIiL
                                 +  D +I+  L + + ++    + E L+ ++  ++L
  gi|1361985   250 --------------KEADTQIPAELyslgyrelvEKLVEYLQSKRYIVVL 285  

                   DDVDdleQLd....ALAketqWFGpGSRIIVTTeDkqLLka.HgInhtIY
                   DDV    +  + + AL + +    +GSR+  TT D      ++gI  t  
  gi|1361985   286 DDVWTTGLWReisiALPDGI----YGSRVMMTTRDMNVASFpYGIGSTKH 331  

                   eVgfPSkeeALqIFCrsAFgQnsPpdGFeeL..eAreVtkLaGnLPLGLr
                   e ++  ++eA   F   AF  +  +   ++L++ Ar+ ++++  LPL+  
  gi|1361985   332 EIELLKEDEAWVLFSNKAFPASLEQCRTQNLepIARKLVERCQGLPLAIA 381  

                   VlGSsLR.GkskeeWedmLpRLrtsfgnsLDgk.....IekvLrvsYDgL
                    lGS + + k + eW+++   L       L+ +++ + + ++   s+++L
  gi|1361985   382 SLGSMMStKKFESEWKKVYSTLNW----ELNNNhelkiVRSIMFLSFNDL 427  

                   hekDqaLFLhIACf...FN.gekvdyVkalLadsnnLDVrqG........
                       +  FL+   f+ + + ++k  ++  + a   ++    G + ++  +
  gi|1361985   428 PYPLKRCFLYCSLFpvnYRmKRK-RLIRMWMAQR-FVEPIRGvkaeevad 475  

                   ..LkvLadKSLIhisplgnedkvdgtieMHnLLqqLGReAIVrkQsidhd
                   + L+ L+++   ++  ++   +  +  +MH+   + +   +   + +   
  gi|1361985   476 syLNELVYRNMLQVILWNPFGR-PKAFKMHDVIWEIALS-VSKLERF--- 520  

                   ePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtseieeelnIsekAF
                                 cdV +d+++ g                     ++A 
  gi|1361985   521 --------------CDVYNDDSD-G---------------------DDAA 534  

                   egMrNL..qFLriykksfrddgk<-*
                   e M N +++ L i k ++ d+     
  gi|1361985   535 ETMENYgsRHLCIQKEMTPDSIR    557  

gi|8118136|gb|AAF72908.1|: domain 1 of 1, from 1 to 157: score -209.5, E = 0.075
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                                  A A
  gi|8118136     1    -----------------------L--------------------ATA 4    

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L++++S     ++F   + ++ ++++y          r+   D       
  gi|8118136     5 LYNKIS-----HQFSVYCLIDDVSKIY----------RH---DGP----- 31   

                   LhLQeqfLSkILnqkDikIhdHL....GvieERLkdqKVLIiLDDVDdle
                    + Q+q L + L+ ++++ + +L + +  i+ RL++ K LIiLD VD++e
  gi|8118136    32 MSAQKQILCQTLGEEHLQMC-NLynasNLIRSRLRHVKSLIILDNVDHVE 80   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   QL+ LA   +W G GSRII +T D ++Lk +g++  +Y+V +  +   Lq
  gi|8118136    81 QLEKLAVSREWLGAGSRIIMITRDEHILKVYGVDV-VYKVPLLNNTNSLQ 129  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    F + AF+ +    G+ +L                               
  gi|8118136   130 LFSQKAFKLDHIISGYDKL------------------------------- 148  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                                                                     
  gi|8118136     - -------------------------------------------------- -    

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                                                                     
  gi|8118136     - -------------------------------------------------- -    

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                        A                                            
  gi|8118136   149 -----A-------------------------------------------- 149  

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                           ++I                      +  +   
  gi|8118136   150 --------FDI---------------------LSYAN    157  

gi|10440622|gb|AAG16860.1|AC069145_9: domain 1 of 1, from 172 to 524: score -209.7, E = 0.076
                   *->rDFddlVG..iEaHlekmksLL.cLdskdeVrMVGIwGPaGIGKTTI
                          d+VG+ +E+  +++   L++ ds  +V  V I+GP GIGKTT 
  gi|1044062   172    ----DIVGtaMEDDARRLVRRLtQPDS-GGV--VAIYGPDGIGKTTL 211  

                   ARALfs..qLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeY
                   A++ f++++       ++F+ +  +  +rg+ +              D  
  gi|1044062   212 AKVVFDseRVK-----RRFETRSWVHVSRGCVE--------------DGK 242  

                   syGmKLhLQeqfLSkILnqkDikIhdHLGv.........ieERL....kd
                           +  +LS++       ++   G++++ ++  ++e +L     +
  gi|1044062   243 R-------EAALLSQVVEA---VVD-GGGAttgaetvaeLERMLaalvAN 281  

                   qKVLIiLDDVDdleQLdALAke.tqWFGpGSRIIVTTeDkqLLkaHgInh
                   ++ L++LD V +    + L+    +  G GS + VT       +  g  h
  gi|1044062   282 RRFLLVLDEVRNGGEWEELVRRlLERGGRGSKVLVTAVTAGVARDMGAGH 331  

                   tIYeVgfPSkeeALqIFCrsAFgQnsPpdGFeeL..eAreVtkLaGnLPL
                    +  V    +++    +   A     + dG   L+++ r+++  +G  PL
  gi|1044062   332 -VHRVNRLGEDDGWALLRVAA---CVADDGGAALrgVGRRIVGKCGGVPL 377  

                   GLrVlGSsLR..GkskeeW..edmLpRLrtsfgnsLDgkIekvLrvsYDg
                   + r +   LR++    eeW  +d+ p  +    ++L ++ +k L  +YD+
  gi|1044062   378 AIRAVAGVLRtrEAIAEEWavVDASPAWKV---KGLPDDAMKPLYLCYDD 424  

                   LhekDqaLFLhIACfFNgekvd...yVkalLadsnnLDVrqGLkvLadKS
                      + +  FL+   f   + vd++++V +++a+                 
  gi|1044062   425 MPCHLKQCFLYCSLFLSDFAVDrrsLVQQWIAEG---------------- 458  

                   LIhisplgnedkvdgtieMHnLLqqLGReAIVrkQsidhdePgKRqFLvD
                    ++i+  g++                G e  V ++  d  e   R  L  
  gi|1044062   459 FVQIR--GDA----------------GVE-EVAEEYYD--ELIGRNLLQP 487  

                   aeeIcdVLtdnTGtgtrsVlGIslDtseieeelnIsekAFegMrNLqFLr
                   ae      +d  G                  e +   + ++ M   q L+
  gi|1044062   488 AE------ADRHGCV----------------ERCTMHDTLRSMA--QVLS 513  

                   iykksfrddgk<-*
                     +++++d++    
  gi|1044062   514 HGENLTGDAQA    524  

gi|9758141|dbj|BAB08633.1|: domain 1 of 1, from 172 to 483: score -209.9, E = 0.078
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIA..
                           lVG++  l ++k  L Ld+   V  V ++GP+G GKTT  ++
  gi|9758141   172    -----LVGLDWPLVELKKKL-LDNS--V--VVVSGPPGCGKTTLVtk 208  

                   ............RALfsqLSerhFqssFqlsaFmenlrgsyskeeigSge
                     ++++ +++ +++ +s  S     +   ++a++ nl    +++  g   
  gi|9758141   209 lcddpeiegefkKIFYSVVS-----NTPNFRAIVQNLL---QDNGCGA-- 248  

                   trpaglDeYsyGmKLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVL
                      + +D+ s                 q     + +L  +eE  kd + L
  gi|9758141   249 ---ITFDDDS-----------------QAETGLR-DL--LEELTKDGRIL 275  

                   IiLDDVDdleQLdALAketqWFGpGSRIIVTTeDkqLLkaHgInh.....
                   ++LDDV              W G+            LL+ + I++++ + 
  gi|9758141   276 LVLDDV--------------WQGSE----------FLLRKFQIDLpdyki 301  

                   .............tIYeVgfPSkee.ALqIFCrsAFgQnsP.....pdGF
                     +++ + ++  +t Y+   P k+e A   + + A    sP+ +++pd +
  gi|9758141   302 lvtsqfdftslwpT-YHLV-PLKYEyARSLLIQWA----SPplhtsPDEY 345  

                   eeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeWedmLpRLrtsfgnsLD
                   e+L  +++ k++  +PL   V+G sL+G     W+ +      +  +  +
  gi|9758141   346 EDL-LQKILKRCNGFPLVIEVVGISLKGQALYLWKGQVESWSEGETILGN 394  

                   gk..IekvLrvsYDgLhekDqaLFLhIACfFNgekvdyVkalLadsnnLD
                    ++++   L+ s++ L  + ++        F  +      ++L d     
  gi|9758141   395 ANptVRQRLQPSFNVLKPHLKE-------CFMDMG-----SFLQDQ---- 428  

                   VrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGReAIVrkQsid
                        k+ a  SLI i+           i M         e        +
  gi|9758141   429 -----KIRA--SLI-ID-----------IWM---------E-------LY 443  

                   hdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtseiee.elnIse
                                           G g           s +++  l+ +e
  gi|9758141   444 ------------------------GRG----------SSSTNKfMLYLNE 459  

                   kAFegMrNLqFLriykksfrddgk<-*
                    A + +  L  L  +k+ +++ ++   
  gi|9758141   460 LASQNLLKLVHLGTNKREDGFYNE    483  

gi|12321041|gb|AAG50637.1|AC082643_1: domain 1 of 1, from 158 to 508: score -210.7, E = 0.085
                   *->rDFd.dlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIAR
                      r  ++d+VG+E   +k+   L  +  d+  +V + G  G GKTT AR
  gi|1232104   158    RGYEsDFVGLEVNVKKLVGYL-VEE-DDIQIVSVTGMGGLGKTTLAR 202  

                   ALfs..qLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsy
                     f+++        ++F   a +  + +          +tr+   +    
  gi|1232104   203 QVFNheDVK-----HQFDRLAWVCVSQE----------FTRK---NV--- 231  

                   GmKLhLQeqfLS.....kILnqkDikIhdHLGvieERLkdqKVLIiLDDV
                    ++  LQ+ + S++++++IL ++  + hd L    + L   K LI+ DD+
  gi|1232104   232 -WQMILQN-LTSretkdEILQMEEAELHDEL---FQLLETSKSLIVFDDI 276  

                   ...DdleQL........dALAketqWFGpGSR........IIVTTeDkqL
                    +++d  + ++  +++++++A       +G R+  + +++   + e   L
  gi|1232104   277 wkeEDWGLInpifppkkETIAM------HGNRryvnfkpeCLTILESWIL 320  

                   LkaHgInhtIYeVgfPSkeeALqIFCrsAFgQnsPpdGFeeLeAreVtkL
                   ++  +I      V+             s F+        e+   ++ +k 
  gi|1232104   321 FQ--RIAMP--RVD------------ESEFK---VDKEMEMM-GKQMIKY 350  

                   aGnLPLGLrVlGSsLR.GkskeeWedmLpRL......rtsfgnsLDgkIe
                   +G LPL+ +VlG  L    + ++W+++   ++ +  +rt+f ++ +  + 
  gi|1232104   351 CGGLPLAVKVLGGLLAaKYTFHDWKRLSENIgchivgRTDFSDGNNSSVY 400  

                   kvLrvsYDgLhekDqaLFLhIACfFN.gekvdyVkalLadsnnLDVrqGL
                    vL  s+++L +  +  FL+ A f  ++ +  +V+     s         
  gi|1232104   401 HVLSLSFEELPSYLKHCFLYLAHFPEdHNI--KVE---KLS--------- 436  

                   kvLadKSLIhisplgnedkvdgtieMHnLLqqLGReAIVrkQsidhdePg
                               ++  e    g+ e         R    + Q i  ++ g
  gi|1232104   437 -----------YCWAAE----GILEP--------RH--YHGQTI--RDVG 459  

                   KRqF..LvDaeeIcdVLtdnTGtgtrsVlGIslDtseieeelnIsekAFe
                   +  +++Lv  +    V ++   t        +++ + +           +
  gi|1232104   460 ESYIeeLVRRN---MVIAERDVTT------LRFEACHLH----------D 490  

                   gMrNLqFLriykksfrddgk<-*
                    Mr    L+ ++    + +    
  gi|1232104   491 MMREVCLLKAKEE--NFVQI    508  

gi|8118188|gb|AAF72929.1|: domain 1 of 1, from 1 to 157: score -211.2, E = 0.091
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                                  AR+
  gi|8118188     1    -----------------------L--------------------ARI 4    

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L+ ++S     s+F  ++F++ l+++y          r+ g+        
  gi|8118188     5 LYRRIS-----SQFDARCFIDDLSKIY----------RHDGPIGA----- 34   

                   LhLQeqfLSkILnqkDikIhdHL....GvieERLkdqKVLIiLDDVDdle
                      Q+q L + L++++ +I+ +L +++  i+ RL+  + LI+ D VD++e
  gi|8118188    35 ---QKQILHQTLGKEHFQIC-NLydttNLIQSRLRRLRALIVVDNVDKVE 80   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   QLd L    qW G GSRII++  D ++Lk +g +  +Y+V +      Lq
  gi|8118188    81 QLDKLGVNRQWLGAGSRIIIISRDEHILKEYGTDV-VYKVPLLNGTNSLQ 129  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    FC+ AF+ +     +e+L                               
  gi|8118188   130 LFCQKAFKLDHTISSYEKL------------------------------- 148  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                           t                                         
  gi|8118188   149 --------T----------------------------------------- 149  

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                                                i+                   
  gi|8118188   150 -----------------------------ID------------------- 151  

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                         I                                           
  gi|8118188   152 ------I------------------------------------------- 152  

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                       ++                     y        +   
  gi|8118188   153 ----LS---------------------Y-------AN    157  

gi|5817339|gb|AAD52713.1|AF123697_1: domain 1 of 1, from 3 to 158: score -211.5, E = 0.094
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                              k +V                   
  gi|5817339     3    ------------------------K-AV------------------- 5    

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    +++++     ++F ++ F++n+r+              ++  e + +  
  gi|5817339     6 -YNRIH-----RKFVDTSFVDNVRE--------------VCEKE-N-RGV 33   

                   LhLQeqfLSkILnqkDikIhdHLGv....ieERLkdqKVLIiLDDVDdle
                    hLQeq+LS I++ k  kIh    v++  ie RLk ++ LI+LDDV  +e
  gi|5817339    34 IHLQEQLLSDIMKAK-QKIH-SIAVgeymIEKRLKGKRALIVLDDVTTVE 81   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkee...
                   QL+AL +  + FGpGS  IV T D  LL   + ++    V+  +++e ++
  gi|5817339    82 QLKALCGNPKFFGPGSVSIVSTRDSRLLNLLNADY----VC--TTKEmde 125  

                   ..ALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGk
                   ++ L+ F  +AF+Q  P+ +F +L ++ V+  +G                
  gi|5817339   126 nqSLELFSWHAFRQPNPRKDFTDL-SVNVVSYCG---------------- 158  

                   skeeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfF
                                                                     
  gi|5817339     - -------------------------------------------------- -    

                   NgekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieM
                                                                     
  gi|5817339     - -------------------------------------------------- -    

                   HnLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsV
                                                                     
  gi|5817339     - -------------------------------------------------- -    

                   lGIslDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                                                                
  gi|5817339     - ------------------------------------------    -    

gi|12325366|gb|AAG52625.1|AC024261_12: domain 1 of 1, from 236 to 637: score -211.7, E = 0.096
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                      +     VG+ a + +m     L + de r     G  G+GKTT    
  gi|1232536   236    KNIHTTVGLYA-MVEMAWK-SLMN-DEIRTLCLHGMGGVGKTTLLAC 279  

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                     +++   + +s F   + +  ++                g+ +      
  gi|1232536   280 INNKFV--ELESEFDVVIWVVVSK-----------DFQLEGIQDQ-ILGR 315  

                   LhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDVDdleQLdA
                   L+L ++           +       i + Lk +K  + LDD+   + L  
  gi|1232536   316 LRLDKE------WERETENK-KASLINNNLKRKKFVLLLDDLWSEVDLNK 358  

                   L.....AketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeAL
                   ++ +++  e     +G  I+ T   k+  k    + +  +V+  S +eA 
  gi|1232536   359 IgvpppTRE-----NGAKIVFTKRSKEVSKYMKADMQ-IKVSCLSPDEAW 402  

                   qIFCrsAFgQ..nsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLR.Gks
                   + F r        s +++   L Ar V+  +  LPL+L V G ++   ++
  gi|1232536   403 ELF-RITVDDviLSSHEDIPAL-ARIVAAKCHGLPLALIVIGEAMAcKET 450  

                   keeWedmLpRLrtsfgn...sLDgkIekvLrvsYDgLhek.DqaLFLhIA
                    +eW  ++  L +  g++ ++  ++I  vL++sYD+L + + +  FL+  
  gi|1232536   451 IQEWHHAINVLNSPAGHkfpGMEERILLVLKFSYDSLKNGeIKLCFLYCS 500  

                   Cf...FNgekvdyVkalLadsnnLD........VrqGLkvLadKSLIhis
                    f+++F  ek ++++ ++ +    ++++ ++++ +qG  +     L++  
  gi|1232536   501 LFpedFEIEKEKLIEYWICEG-YINpnryedggTNQGYDIIG--LLVRAH 547  

                   plgnedkvdgtieMHnLLqqLGReAIVrkQsidhdePgKRq..FLvDaee
                    l ++ ++   ++MH   ++++   I       + + gK q+++ v +  
  gi|1232536   548 LLIEC-ELTTKVKMHYVIREMALW-I-------NSDFGKQQetICVKSGA 588  

                   IcdVLtdnTGtgtrsVlGIslDtseieeelnIsekAFegMrNLqFLriyk
                         +++  +   V   sl  + ie +++ s k     +NL  L    
  gi|1232536   589 HVRMIPNDINWE--IVRQVSLISTQIE-KISCSSKC----SNLSTLLLPY 631  

                   ksfrddgk<-*
                   +  +  +    
  gi|1232536   632 N--KLVNI    637  

gi|11994217|dbj|BAB01339.1|: domain 1 of 1, from 167 to 558: score -212.1, E = 0.1
                   *->rDFddlVGiEaHlekmksLLcLds..kdeVrMVGIwGPaGIGKTTIA
                       D  +  G ++   ++   L  +++++++   V I G  G+GKTT  
  gi|1199421   167    VDESEVFGRDDDKDEIMRFLIPENgkDNGITVVAIVGIGGVGKTTLS 213  

                   RALfs.qLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsy
                     L+++q+           s F ++++      +  S      ++D    
  gi|1199421   214 QLLYNdQHV---------RSYFGTKVW------AHVS-----EEFDVFK- 242  

                   GmKLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKV..LIiLDDV...
                          e   S      D+ +  +   ++ERL     + L++LDD+ ++
  gi|1199421   243 -ITKKVYESVTSRPCEFTDLDVL-QV-KLKERLTGTGLpfLLVLDDLwne 289  

                   .....DdleQLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVg
                   +  + D l Q    A        GS I VTT  +         h +    
  gi|1199421   290 nfadwDLLRQPFIHAA------QGSQILVTTRSQRVASIMCAVH-VHNLQ 332  

                   fPSkeeALqIFCrsAFgQnsPp..dGFeeLeAreVtkLaGnLPLGLrVlG
                     S+++    F    Fg   P  +    +L A+++++ +  LPL+ + lG
  gi|1199421   333 PLSDGDCWSLFMKTVFGNQEPClnREIGDL-AERIVHKCRGLPLAVKTLG 381  

                   SsLR..GkskeeWedmL.pRLrtsfgnsLDg.kIekvLrvsYDgLhekDq
                     LR +Gk   eWe++L+ R+        D ++   vLrvsY  L  + +
  gi|1199421   382 GVLRfeGKV-IEWERVLsSRIWD---LPADKsNLLPVLRVSYYYLPAHLK 427  

                   aLFLhIACf..FN.gekvdyVkalLadsnnLDVrqGLkvLad........
                     F +  +f++ +  ek++ V  + a+  +L  +   k+L + +++  ++
  gi|1199421   428 RCFAYCSIFpkGHaFEKDKVVLLWMAEG-FLQQTRSSKNLEElgneyfse 476  

                   ...KSLIhisplgnedkvdgtieMHnLLqqLGReAIVrkQsidhdePgKR
                    +++SL + +        + +  MH+   +L+  A     s +       
  gi|1199421   477 lesRSLLQKT--------KTRYIMHDFINELAQFA-----S-G------- 505  

                   qFLvDaeeIcdVLtdnTGtgtrsVlGIslDtseieeelnIsekAFegMrN
                   +F   +e+ c  L     t+          +s +    + +   Fe +r 
  gi|1199421   506 EFSSKFEDGCK-LQVSERTR---------YLSYLR-DNYAEPMEFEALRE 544  

                   LqFLriykksfrddgk<-*
                    +FLr +     + ++   
  gi|1199421   545 VKFLRTFLP--LSLTN    558  

gi|10177352|dbj|BAB10695.1|: domain 1 of 1, from 160 to 591: score -212.6, E = 0.11
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIAR.
                          dlVG E   e++   L  ++ d    V I G  GIGKTT AR+
  gi|1017735   160    SSESDLVGVEQSVEELVGHL-VEN-DIYQVVSIAGMGGIGKTTLARq 204  

                   .ALfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyG
                    + +++       + F   a +  +                       + 
  gi|1017735   205 vFHHDLVR-----RHFDGFAWVCVSQQ---------------------FT 228  

                   mKLhLQeqfLSkILnqkDikIhdHL..Gvie....ERLkdqKVLIiLDDV
                   +K  +Q+ +  + L   D  I  + ++ +++++  + L   + L++LDDV
  gi|1017735   229 LKHVWQRIL--QELQPHDGNIL-QMdeSALQpklfQLLETGRYLLVLDDV 275  

                   ......DdleQLdALAketqWFGpGSRIIVTTeDkqLLkaH....gI...
                    ++++ D ++   +   +  W             k LL + +++ gI+ +
  gi|1017735   276 wkkedwDRIK--AVFPRKRGW-------------KMLLTSRnegvGIhad 310  

                   ..nhtIYeVgfPSkeeALqIFCrsAF.....gQnsPpdGFeeLeAreVtk
                   ++ +t    +    ee  +   r  F+++++ +    +  e    +e ++
  gi|1017735   311 ptCLT-FRASILNPEESWKLCERIVFprrdeTEVRLDEEMEAM-GKEMVT 358  

                   LaGnLPLGLrVlGSsLR.GkskeeWedmLpRLrtsf..gnsLDgk....I
                   ++G LPL+ + lG  L +  +  eW+++   + + + +g +LD+++ +++
  gi|1017735   359 HCGGLPLAVKALGGLLAnKHTVPEWKRVSDNIGSQIvgGSCLDDNslnsV 408  

                   ekvLrvsYDgLhekDqaLFLhIA...........CfFNgekvdyVka..l
                     +L  sY++L  + +  FL+ A+ +++++  ++ +FN+  ++ + +++ 
  gi|1017735   409 NRILSLSYEDLPTHLKHRFLYLAhfpedskiytqDLFNYWAAEGIYDgsT 458  

                   LadsnnLDVrqGLkvLadKSLIhisplgned.kv.dgtieMHnLLqqLGR
                   + ds+    ++ L+ L+ + L+  +   n+   ++  ++ MH++     R
  gi|1017735   459 IQDSG----EYYLEELVRRNLVIAD---NRYlSLeFNFCQMHDMM----R 497  

                   eAIVrk......................QsidhdePgKRqFLvDaeeIcd
                   e ++  + ++++  +  ++++++++ + Qs      + R+F + +     
  gi|1017735   498 E-VCLSkakeenflqiikdptststinaQSP----SRSRRFSIHSGKAFH 542  

                   VLtdnTGtgtrsVlGIslDtseieeelnI.sekAFegMrNLqFLriykks
                   +L +    + rs +     +s+ ee + I+s ++F  ++ L+ L   +  
  gi|1017735   543 ILGHRNNPKVRSLI-----VSRFEEDFWIrSASVFHNLTLLRVLDLSRV- 586  

                   frddgk<-*
                    +++g    
  gi|1017735   587 -KFEGG    591  

gi|6721550|dbj|BAA89580.1|: domain 1 of 1, from 178 to 567: score -213.6, E = 0.12
                   *->rDFddlVGiEaHlekmksLLcLdskde.......VrMVGIwGPaGIG
                       D   lVG +   +++  LL  +  d+++++  +++ V + G  G G
  gi|6721550   178    VDESRLVGVRSKTRAILKLLEHKD-DGdddglarRKVVAVVGFGGLG 223  

                   KTTIARALfsqLSerhFqssFqlsaFmenlrgsysk..............
                   KTT A   +            +++aF++  r +  +   ++  ++   + 
  gi|6721550   224 KTTLAAMVYKSPAV----QGIHHRAFVTVTRSCNLRamleslleqlfapa 269  

                   .eeigSgetrpaglDeYsyGmKLhLQeqfLSkILnqkDik.IhdHLGvie
                   ++   S+   +++  e +             +IL+    k+I++ L    
  gi|6721550   270 rDPRCSR--KEIMAMEKD-------------EILRGIETKdIPQLLAHCS 304  

                   ERLkdqKVLIiLDD...VDdleQLd.ALAketqWFGpGSRIIVTTeDkqL
                     L d++ +I+ DD  +++d   L++A  +  +     SRII+TT ++q 
  gi|6721550   305 THLSDKRYFIVVDDlwsLEDWASLKpAFPDNDK----HSRIIITTRNRQV 350  

                   ......LkaHgInhtIYeVgfPSkeeALqIFCrsAFgQnsPpdGFeeL..
                    ++  +L   ++      V    ++   + F    F +   p  +  L++
  gi|6721550   351 aesccsLPGDRVHFM--DVL--PNDQSRELFFKTVFQKEHCPSEYRSLeg 396  

                   eAreVtkLaGnLPLGLrVlGSsLRG...kskeeWedmLpRLrtsfgnsLD
                    +  + + +G LPL+   +G  L   ++k+  eW ++   L +  g s  
  gi|6721550   397 ISGDILTKCGGLPLAIVSVGGMLAQaenKTPVEWTKVCGKLGS--GLSTS 444  

                   gkI...ekvLrvsYDgLhekDqaLFLhIACfFN.gekvd..yVkalLads
                     +++   +L  sY +L  + +a FL+  +f  ++e+  +++V  + a+ 
  gi|6721550   445 AAVrgmRRILSLSYHDLPYHLKACFLYLSVFREgYEIKRgpLVRRWAAEG 494  

                   nnLDVrqGLkvLadKSLIhisplgned.kvdgtieMHnLLqqLGReAIVr
                                      +  ++++ ++           +  G+  I  
  gi|6721550   495 ------------------FVGGGREWTpE-----------EAAGKY-I-- 512  

                   kQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtseieeel
                         de   R + + ++    V t++    + +V  I l++   +   
  gi|6721550   513 ------DEFVGRSIVTPTR----VATNGVVRCC-KVHDIMLEVMTAK--- 548  

                   nIsekAFegMrNLqFLriykksfrddgk<-*
                   +++e+         F +   + +++  +   
  gi|6721550   549 CVEEN---------FISLLGSVTSYGRH    567  

gi|7489350|pir||T30562: domain 1 of 1, from 148 to 515: score -213.9, E = 0.13
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         dd+   E   +  + L  L+  +   MV  +G  G+GKT   R 
  gi|7489350   148    SLSDDFPSREK--TFTQALKALEPNQKFHMVALCGMGGVGKT---RM 189  

                   LfsqLSerhFq.ssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGm
                   +  +L   +  +++  ++ +++ + g   +      + +   + +Y   +
  gi|7489350   190 MQ-RLK--KAAeEKKLFNYIVGAVIGEKTDP-----FAIQEAIADY---L 228  

                   KLhLQeqfLSkILnqkDikIhdHLGvieERLk......dqKVLIiLDDVD
                     +L e+        k  + +  L   +E+ k++++++  K LI+LDDV 
  gi|7489350   229 GIQLNEK-------TKPARAD-KL---REWFKknsdggKTKFLIVLDDVW 267  

                   dleQLdALAketqWF...GpGSRIIVTTeDkqLLkaHgInht.IYeVgfP
                   +l+ L+ +    + F+++G    +  T  D q     g++ ++I  Vg+ 
  gi|7489350   268 QLVDLEDIGL--SPFpnqGVDFKVLLTSRDSQVCTMMGVEANsIINVGLL 315  

                   SkeeALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLR
                   ++ eA   F +  F ++s p+  +++  + +++ +  LP + + +   LR
  gi|7489350   316 TEAEAQSLFQQ--FVETSEPEL-QKI-GEDIVRKCCGLPIAIKTMACTLR 361  

                   GkskeeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLhek.DqaLFLhIA
                    k k+ W+d+L R++      ++    kv   sY  L e++ ++ FL   
  gi|7489350   362 NKRKDAWKDALSRIEH---YDIHNVAPKVFETSYHNLQEEeTKSTFLMCG 408  

                   CfFNgekvdyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgt
                    f   ++    ++l           GLk       I+  +++     + +
  gi|7489350   409 LFPEDFD-IPTEELMRYG------WGLKLFDRVYTIREARTRL----NTC 447  

                   ieMHnLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgt
                   ie         R  +   Q +          L+++ +   V  ++     
  gi|7489350   448 IE---------RL-V---QTN---------LLIESDDVGCVKMHDLVRA- 474  

                   rsVlGIslDtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                     VlG+    se+e+  +++     g ++     ++ +++++ +    
  gi|7489350   475 -FVLGM---FSEVEHASIVNHGNMPGWPDENDMIVHSCKRISLTC    515  

gi|8118117|gb|AAF72900.1|: domain 1 of 1, from 1 to 157: score -214.3, E = 0.13
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                                  AR+
  gi|8118117     1    -----------------------L--------------------ARI 4    

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L+ ++S     s+F   +F++ ++              +++ ++      
  gi|8118117     5 LYRRIS-----SQFDACCFIDDVS--------------KICKHD----GP 31   

                   LhLQeqfLSkILnqkDikIhdHLG....vieERLkdqKVLIiLDDVDdle
                      Q+q LS+ L+ ++++I+ +L ++ + i++RL + + +IiLD VD+ e
  gi|8118117    32 VAAQKQILSQTLGEEHLQIC-NLSdganLIQNRLGHLRAFIILDNVDQGE 80   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   QL+ LA      G GSRII++  D ++L  +g++  + +V +  +   Lq
  gi|8118117    81 QLEKLAVNLMRLGVGSRIIIISRDTHILNRYGVDV-VFKVPLLNQTNSLQ 129  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    FC+ AF+++     +eeL+                              
  gi|8118117   130 LFCQQAFKRDNILSNYEELV------------------------------ 149  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                                                                 +e+ 
  gi|8118117   150 ----------------------------------------------YEI- 152  

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                                             L                       
  gi|8118117   153 --------------------------LNY--------------------- 155  

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                        A                                            
  gi|8118117   156 -----A-------------------------------------------- 156  

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                        +                                  
  gi|8118117   157 -----D-------------------------------    157  

gi|8118113|gb|AAF72898.1|: domain 1 of 1, from 1 to 157: score -215.8, E = 0.16
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                                  AR+
  gi|8118113     1    -----------------------L--------------------ARI 4    

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L+ ++S     s+F   +F++ ++              +++ ++      
  gi|8118113     5 LYRRIS-----SQFDACCFIDDVS--------------KICKHD----GP 31   

                   LhLQeqfLSkILnqkDikIhdHLG....vieERLkdqKVLIiLDDVDdle
                      Q+q LS+ L+ ++++I+ +L ++ + i++RL + + +IiLD VD+ e
  gi|8118113    32 VAAQKQILSQTLGEEHLQIC-NLSdganLIQNRLGHLRAFIILDNVDQGE 80   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   QL+ LA      G GSRII++  D ++L  +g++  + +V +  +   Lq
  gi|8118113    81 QLEKLAVNRMRLGIGSRIIIISRDTHILNRYGVDV-VFKVPLLNQTNSLQ 129  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    FC+ AF+++     +eeL+                              
  gi|8118113   130 LFCQQAFKRDNILSNYEELV------------------------------ 149  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                                                                 +e+ 
  gi|8118113   150 ----------------------------------------------YEI- 152  

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                                             L                       
  gi|8118113   153 --------------------------LNY--------------------- 155  

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                        A                                            
  gi|8118113   156 -----A-------------------------------------------- 156  

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                        +                                  
  gi|8118113   157 -----D-------------------------------    157  

gi|6721549|dbj|BAA89579.1|: domain 1 of 1, from 170 to 554: score -215.9, E = 0.16
                   *->rDFddl......VGiEaHlekmksLLcLdskde....VrMVGIwGPa
                      r+ ddl+++ +    ++  ++   LL++  +d+++ +++ V I G  
  gi|6721549   170    RCYDDLdrrlpaLSVDDKTRAVLKLLDMVGDDDgsarRKVVSIVGFG 216  

                   GIGKTTIARALfsqLSerhFq.ssFqls...........aFmenlrgsys
                   G GKTT A   +   S+    + + +l ++++ +  ++ a   n r    
  gi|6721549   217 GLGKTTLAAMVYK--SPAGIRdGDPELQpsssagivggaALRANAR---- 260  

                   keeigSgetrpaglDeYsyGmKLhLQeqfLSkILnqkDikIhdHLGvieE
                          +t  ++ D+++  +   L+       +  kDi     L     
  gi|6721549   261 -------FTLLHEEDDHG--SRRILRG------IETKDIPQL--LAHCST 293  

                   RLkdqKVLIiLDDVDdleQLdALA.....ketqWFGpGSRIIVTTeDkqL
                    L+d++ +++ DDV  le    L +  ++++++     SR+++TT ++q 
  gi|6721549   294 HLRDKRYFVVVDDVWSLEDWASLKpafpdNDIH-----SRVVITTRNRQV 338  

                   LkaHg...InhtIYeVgfPSkeeALqIFCrsAFgQnsPpdGFeeL..eAr
                    ++  + +++  +Y  +   ++   + F    F+ n  p G+  L++ + 
  gi|6721549   339 AESCCslpVDR-VYSMDVLQDDQSRKLFFNTVFRSNKCPAGYRRLetISG 387  

                   eVtkLaGnLPLGLrVlGSsLRG...kskeeWedmLpRLrtsfgnsLD...
                    +   +G LPL+   +G  L   ++k+  eW+++  RL +    +L ++ 
  gi|6721549   388 NILAKCGGLPLAIVSVGGMLAQaenKTPAEWMKVCDRLGS----RLStsa 433  

                   ..gkIekvLrvsYDgLhekDqaLFLhIACfFN.gekvd..yVkalLadsn
                     ++   +   sY +L  + +a FL+  +f  ++e+  +++V  + a+  
  gi|6721549   434 mmERMRRIMSLSYHDLLYHLKACFLYLSVFREgYEIKRgpLVRRWAAEG- 482  

                   nLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLqqLGReAIVrkQ
                   ++  r              +p++ +                G+       
  gi|6721549   483 FVGGRR-----------ECTPEEAA----------------GKY------ 499  

                   sidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIslDtseieeelnI
                     d  e   R + + ++    V +++    + +V  I l++   +   ++
  gi|6721549   500 -LD--EFVGRSIVTPTR----VVSNGVVRCC-KVHDIMLEMMTEK---CM 538  

                   sekAFegMrNLqFLriykksfrddgk<-*
                   +e+         F +   +  +++g+   
  gi|6721549   539 EEN---------FISLLGS-PSKHGH    554  

gi|8118205|gb|AAF72936.1|: domain 1 of 1, from 1 to 157: score -216.0, E = 0.16
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                                  AR+
  gi|8118205     1    -----------------------L--------------------ARI 4    

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L+ ++S     s+F   +F++ ++              +++ ++      
  gi|8118205     5 LYRRIS-----SQFDACCFIDDVS--------------KICKHD----GP 31   

                   LhLQeqfLSkILnqkDikIhdHLG....vieERLkdqKVLIiLDDVDdle
                      Q+q LS+ L+ ++++I+ +L ++ + i++RL + + +IiLD VD+ e
  gi|8118205    32 VAAQKQILSQTLGEEHLQIC-NLSdganLIQNRLGHLRAFIILDNVDQGE 80   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   QL+ LA      G GSRII++  D ++L  +g++  + +V +  +   Lq
  gi|8118205    81 QLEKLAVNRMQLGVGSRIIIISRDTHILNRYGVDV-VFKVPLLNQTNSLQ 129  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    FC+ AF+++     +eeL+                              
  gi|8118205   130 LFCQQAFKRDNILSNYEELV------------------------------ 149  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                                                                 +e+ 
  gi|8118205   150 ----------------------------------------------YEI- 152  

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                                             L                       
  gi|8118205   153 --------------------------LNY--------------------- 155  

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                        A                                            
  gi|8118205   156 -----A-------------------------------------------- 156  

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                        +                                  
  gi|8118205   157 -----D-------------------------------    157  

gi|8118110|gb|AAF72897.1|: domain 1 of 1, from 1 to 157: score -216.0, E = 0.16
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                                  AR+
  gi|8118110     1    -----------------------L--------------------ARI 4    

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L+ ++S     s+F   +F++ ++              +++ ++      
  gi|8118110     5 LYRRIS-----SRFDACCFIDDVS--------------KICKHD----GP 31   

                   LhLQeqfLSkILnqkDikIhdHLG....vieERLkdqKVLIiLDDVDdle
                      Q+q LS+ L+ ++++I+ +L ++ + i++RL + + +IiLD VD+ e
  gi|8118110    32 VAAQKQILSQTLGEEHLQIC-NLSdganLIQNRLGHLRAFIILDNVDQGE 80   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   QL+ LA      G GSRII++  D ++L  +g++  + +V +  +   Lq
  gi|8118110    81 QLEKLAVNRMRLGIGSRIIIISRDTHILNRYGVDV-VFKVPLLNQTNSLQ 129  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    FC+ AF+++     +eeL+                              
  gi|8118110   130 LFCQQAFKRDNILSNYEELV------------------------------ 149  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                                                                 +e+ 
  gi|8118110   150 ----------------------------------------------YEI- 152  

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                                             L                       
  gi|8118110   153 --------------------------LNY--------------------- 155  

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                        A                                            
  gi|8118110   156 -----A-------------------------------------------- 156  

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                        +                                  
  gi|8118110   157 -----D-------------------------------    157  

gi|8118208|gb|AAF72937.1|: domain 1 of 1, from 1 to 157: score -216.0, E = 0.16
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                                                                  AR+
  gi|8118208     1    -----------------------L--------------------ARI 4    

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                   L+ ++S     s+F   +F++ ++              +++ ++      
  gi|8118208     5 LYRRIS-----SQFDACCFIDDVS--------------KICKHD----GP 31   

                   LhLQeqfLSkILnqkDikIhdHLG....vieERLkdqKVLIiLDDVDdle
                      Q+q LS+ L+ ++++I+ +L ++ + i++RL + + +IiLD VD+ e
  gi|8118208    32 VAAQKQILSQTLGEEHLQIC-NLSdganLIQNRLGHLRAFIILDNVDQGE 80   

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   QL+ LA      G GSRII++  D +LL  +g++  + +V +  +   Lq
  gi|8118208    81 QLEKLAVNRMRLGIGSRIIIISRDTHLLNRYGVDV-VFKVPLLNQTNSLQ 129  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                    FC+ AF+++     +eeL+                              
  gi|8118208   130 LFCQQAFKRDNILGNYEELV------------------------------ 149  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                                                                 +e+ 
  gi|8118208   150 ----------------------------------------------YEI- 152  

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                                             L                       
  gi|8118208   153 --------------------------LNY--------------------- 155  

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                        A                                            
  gi|8118208   156 -----A-------------------------------------------- 156  

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                        +                                  
  gi|8118208   157 -----D-------------------------------    157  

gi|7489516|pir||T03031: domain 1 of 1, from 28 to 313: score -216.2, E = 0.16
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMV...GIwGPaGIGKTTI
                          +lVG E  +++ +   +L      + V +  I G  G+GKTT 
  gi|7489516    28    ----NLVGKEV-IRACREVVDLVVARKKKNVyklAIVGTGGVGKTTL 69   

                   ARALfs..qLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeY
                   A   f++++L       +F ++a    ++                   eY
  gi|7489516    70 AQKIFNdkKLE-----GRFDHHAWACVSK-------------------EY 95   

                   syGmKLhLQeqfLSkILnqkDik......IhdHL.GvieERLkdqKVLIi
                   s       +  +L ++L+  +i+ +++++++  L+  i+    ++  +++
  gi|7489516    96 S-------RDSLLRQVLRNMGIRyeqdesVP-ELqRKIKSHIANKSFFLV 137  

                   LDDVDdleQ........LdALAketqWFGpGSRIIVTTeDkqLLkaHgIn
                   LDDV ++e  ++  +++L A A      G    I +TT D  + +  g++
  gi|7489516   138 LDDVWNSEAwtdllstpLHAAAT-----GV---ILITTRDDTIARVIGVD 179  

                   htIYeVgfPSkeeALqIFCrsAFgQnsPp.dGFeeLeAreVtkLaGnLPL
                   ht   V++ S +   + + rs       +    +++   e+++ +G LPL
  gi|7489516   180 HT-HRVDLMSADVGWELLWRSMNINQEKQvQNLKDI-GIEIVRKCGGLPL 227  

                   GLrVlGSsLR..GkskeeWedmLpRLrtsfgnsLDgkIekvLrvsYDgLh
                   + rV    L ++  +++eW ++L     s    L ++    L  sY+ L 
  gi|7489516   228 AIRVIATVLAsqEQTENEWRRILGKNAWS-MSKLPRELSGALYLSYEVLP 276  

                   ekDqaLFLhIACfFNgekvdyVkalLadsnnLDVrqGLkvLadKSLIhis
                   ++ +  FL+ A f   e+                              i 
  gi|7489516   277 HQLKQCFLYCALFPEDET------------------------------IL 296  

                   plgnedkvdgtieMHnLLqqLGReAIVrkQsidhdePgKRqFLvDaeeIc
                                         R+ I                        
  gi|7489516   297 ----------------------RD-I-----L------------------ 300  

                   dVLtdnTGtgtrsVlGIslDtseieeelnIsekAFegMrNLqFLriykks
                           t+                                  ++ +  
  gi|7489516   301 --------TR---------------------------------MWVAEA- 308  

                   frddgk<-*
                     +  k   
  gi|7489516   309 -LWMRK    313  

gi|9858468|gb|AAG01047.1|: domain 1 of 1, from 23 to 172: score -216.6, E = 0.17
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                         d  VG+    ek++ LL   s d+  M+GI G  G+GK+T ARA
  gi|9858468    23    --ADHPVGLHLEVEKIRKLLEAGSSDAISMIGIHGMGGVGKSTLARA 67   

                   LfsqLSerhFqssFqlsaFmenlrgsyskeeigSgetrpaglDeYsyGmK
                    ++++      + F +s+F  n+r                +++ ++  +K
  gi|9858468    68 VYNLHT-----DHFDDSCFLQNVR---------------EESNRHG--LK 95   

                   LhLQeqfLSkILnqkDikIh....dHLGvieERLkdqKVLIiLDDVDdle
                    +LQ  +LS+IL+ k i   +++++    i++ Lk +KVL++LDDVD  +
  gi|9858468    96 -RLQSILLSQILK-KEINLAseqqG-TSMIKNKLKGKKVLLVLDDVDEHK 142  

                   QLdALAketqWFGpGSRIIVTTeDkqLLkaHgInhtIYeVgfPSkeeALq
                   QL A+++++ W                                       
  gi|9858468   143 QLQAIVGKSVW------------------------S-------------- 154  

                   IFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGLrVlGSsLRGkskeeW
                                      e                              
  gi|9858468   155 -------------------E------------------------------ 155  

                   edmLpRLrtsfgnsLDgkIekvLrvsYDgLhekDqaLFLhIACfFNgekv
                                                                     
  gi|9858468     - -------------------------------------------------- -    

                   dyVkalLadsnnLDVrqGLkvLadKSLIhisplgnedkvdgtieMHnLLq
                            s                                        
  gi|9858468   156 ---------S---------------------------------------- 156  

                   qLGReAIVrkQsidhdePgKRqFLvDaeeIcdVLtdnTGtgtrsVlGIsl
                       e       +                         Gt+         
  gi|9858468   157 ----E-------F-------------------------GTR--------- 161  

                   DtseieeelnIsekAFegMrNLqFLriykksfrddgk<-*
                           + I               i ++    d++   
  gi|9858468   162 -------LVLI---------------ITTR----DKQ    172  

gi|14475935|gb|AAK62782.1|AC027036_3: domain 1 of 1, from 158 to 527: score -217.5, E = 0.19
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                       D  d+VG+Ea  +k+   L  +    V  V I G  G GKTT A+ 
  gi|1447593   158    DDDSDFVGLEANVKKLVGYLVDEAN--VQVVSITGMGGLGKTTLAKQ 202  

                   Lfs..qLSerhFqssFqlsaFm....enlrgsyskeeigSgetrpaglDe
                    f+++        ++F     +  +++  r + +       +++      
  gi|1447593   203 VFNheDVK-----HQFDGLSWVcvsqDFTRMNVW-------QKIL----- 235  

                   YsyGmKLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDV..
                   ++  +K   +e+   kI+ +         G +   L   K LI+LDD+ +
  gi|1447593   236 RD--LKPKEEEK---KIMEMTQDTLQ---GELIRLLETSKSLIVLDDIwe 277  

                   .DdleQLdALAketqWFGpGSRIIVTTeDkqLLkaHg...InhtIYeVgf
                   ++d e+ + +   t+    G  +  T  +    +  +++ In +  e ++
  gi|1447593   278 kEDWELIKPIFPPTK----GWKVLLTSRNESVAMRRNtsyINFK-PE-CL 321  

                   PSkee.......ALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGL
                    +++  +  ++ AL +     F+ +  ++   +L     +k++G LPL+ 
  gi|1447593   322 TTEDSwtlfqriALPMKDAAEFKIDEEKEELGKL----MIKHCGGLPLAI 367  

                   rVlGSsLRGk.skeeWedmLpRL.......rtsfgnsLDgkIekvLrvsY
                   rVlG  L  k + ++W ++   ++++  ++rt f +  +     vL  s+
  gi|1447593   368 RVLGGMLAEKyTSHDWRRLSENIgshlvggRTNFNDDNNNTCNYVLSLSF 417  

                   DgLhekDqaLFLhIACfFN.gek.vdyVkalLadsnnLDVrqGLkvLadK
                   ++L +  +  FL+ A f  ++e++v+++  + a+ +              
  gi|1447593   418 EELPSYLKHCFLYLAHFPDdYEInVKNLSYYWAAEG-------------- 453  

                   SLIhisplgnedkvdgtieMHnLLqqLGReAIVrk...QsidhdePgKRq
                     I   p + +                  e I+r  ++  i  +e   R 
  gi|1447593   454 --IF-QPRHYD-----------------GE-IIRDvgdVYI--EELVRRN 480  

                   FLvDaeeIcdVLtdnTGtgtrsVlGIslDtseieeelnIsekAFegMrNL
                     +  +        +  t+       +++t+ +    ++ e  + +    
  gi|1447593   481 MVISER--------DVKTS-------RFETCHLH-D-MMREVCLLKAKEE 513  

                   qFLriykksfrddgk<-*
                    FL i  + + ++g+   
  gi|1447593   514 NFLQITSS-RTSTGN    527  

gi|6520173|dbj|BAA87943.1|: domain 1 of 1, from 158 to 527: score -218.0, E = 0.2
                   *->rDFddlVGiEaHlekmksLLcLdskdeVrMVGIwGPaGIGKTTIARA
                       D  d+VG+Ea  +k+   L  +    V  V I G  G GKTT A+ 
  gi|6520173   158    DDDSDFVGLEANVKKLVGYLVDEAN--VQVVSITGMGGLGKTTLAKQ 202  

                   Lfs..qLSerhFqssFqlsaFm....enlrgsyskeeigSgetrpaglDe
                    f+++        ++F     +  +++  r + +       +++      
  gi|6520173   203 VFNheDVK-----HQFDGLSWVcvsqDFTRMNVW-------QKIL----- 235  

                   YsyGmKLhLQeqfLSkILnqkDikIhdHLGvieERLkdqKVLIiLDDV..
                   ++  +K   +e+   kI+ +         G +   L   K LI+LDD+ +
  gi|6520173   236 RD--LKPKEEEK---KIMEMTQDTLQ---GELIRLLETSKSLIVLDDIwe 277  

                   .DdleQLdALAketqWFGpGSRIIVTTeDkqLLkaHg...InhtIYeVgf
                   ++d e+ + +   t+    G  +  T  +    +  +++ In +  e ++
  gi|6520173   278 kEDWELIKPIFPPTK----GWKVLLTSRNESVAMRRNtsyINFK-PE-CL 321  

                   PSkee.......ALqIFCrsAFgQnsPpdGFeeLeAreVtkLaGnLPLGL
                    +++  +  ++ AL +     F+ +  ++   +L     +k++G LPL+ 
  gi|6520173   322 TTEDSwtlfqriALPMKDAAEFKIDEEKEELGKL----MIKHCGGLPLAI 367  

                   rVlGSsLRGk.skeeWedmLpRL.......rtsfgnsLDgkIekvLrvsY