hmmpfam - search one or more sequences against HMM database
HMMER 2.2g (August 2001)
Copyright (C) 1992-2001 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /usr/local/genome/database/Pfam_6.5
Sequence file:            At5g66910.txt
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: At5g66910
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model           Description                             Score    E-value  N 
--------        -----------                             -----    ------- ---
NB-ARC          NB-ARC domain                            82.6    2.4e-24   2
LRR             Leucine Rich Repeat                      48.0      1e-11   4
Viral_helicase1 Viral (Superfamily 1) RNA helicase       15.4    5.7e-05   1
PRK             Phosphoribulokinase / Uridine kinase      5.4       0.08   1
adenylatekinase Adenylate kinase                          5.4       0.12   1
HypB_UreG       HypB/UreG nucleotide-binding domain     -69.3       0.32   1
ABC_tran        ABC transporter                         -75.1        0.9   1
MCR_beta_N      Methyl-coenzyme M reductase beta subu     1.1       0.92   1
AAA             ATPase family associated with various   -51.0       0.97   1
DUF41           Domain of unknown function DUF41        -70.5        1.3   1
K-box           K-box region                            -50.7        2.1   1
DUF164          Uncharacterized ACR, COG1579           -112.1          3   1
SKI             Shikimate kinase                        -92.5          4   1
MatK_N          MatK/TrnK amino terminal region        -134.0        5.7   1
RNA_dep_RNApol2 RNA dependent RNA polymerase           -258.9        5.7   1
PFK             Phosphofructokinase                      -2.7        6.2   1
ACOX            Acyl-CoA oxidase                         -2.0        6.2   1
TSC22           TSC-22/dip/bun family                   -21.2        6.5   1
CK_II_beta      Casein kinase II regulatory subunit    -153.2        6.5   1
rrm             RNA recognition motif. (a.k.a. RRM, R   -19.4        6.7   1
cellulase       Cellulase (glycosyl hydrolase family   -127.6        6.7   1
HAMP            HAMP domain                              -8.1        7.5   1
Peptidase_M3    Peptidase family M3                    -301.2        7.9   1
Fragilysin      Fragilysin metallopeptidase (M10C) en  -204.1        8.4   1
SRP54           SRP54-type protein, GTPase domain        -1.4        9.1   1
Topoisomerase_I Eukaryotic DNA topoisomerase I, catal  -152.1        9.3   1
FH2             Formin Homology 2 Domain               -203.3        9.7   1
IFN-gamma       Interferon gamma                        -52.2        9.9   1

Parsed for domains:
Model           Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------        ------- ----- -----    ----- -----      -----  -------
HAMP              1/1       2    66 ..     1    73 []    -8.1      7.5
cellulase         1/1      24   287 ..     1   375 []  -127.6      6.7
DUF164            1/1      26   279 ..     1   235 []  -112.1        3
Topoisomerase_I   1/1      26   194 ..     1   283 []  -152.1      9.3
Fragilysin        1/1      38   354 ..     1   382 []  -204.1      8.4
Peptidase_M3      1/1      39   640 ..     1   656 []  -301.2      7.9
TSC22             1/1      64   120 ..     1    60 []   -21.2      6.5
NB-ARC            1/2     159   283 ..     7   154 ..    49.6  8.9e-15
HypB_UreG         1/1     181   287 ..     1   147 []   -69.3     0.32
SRP54             1/1     187   209 ..     1    23 [.    -1.4      9.1
ABC_tran          1/1     189   324 ..     1   198 []   -75.1      0.9
SKI               1/1     189   334 ..     1   183 []   -92.5        4
AAA               1/1     191   501 ..     1   216 []   -51.0     0.97
PRK               1/1     191   209 ..     1    19 [.     5.4     0.08
Viral_helicase1   1/1     192   212 ..     1    21 [.    15.4  5.7e-05
adenylatekinase   1/1     194   202 ..     1     9 [.     5.4     0.12
rrm               1/1     204   277 ..     1    77 []   -19.4      6.7
PFK               1/1     263   274 ..   119   130 ..    -2.7      6.2
CK_II_beta        1/1     279   407 ..     1   217 []  -153.2      6.5
ACOX              1/1     332   356 ..   490   519 .]    -2.0      6.2
NB-ARC            2/2     341   440 ..   224   341 ..    33.1  5.2e-10
RNA_dep_RNApol2   1/1     365   719 ..     1   467 []  -258.9      5.7
IFN-gamma         1/1     391   511 ..     1   138 []   -52.2      9.9
FH2               1/1     404   799 ..     1   503 []  -203.3      9.7
MatK_N            1/1     442   693 ..     1   277 []  -134.0      5.7
DUF41             1/1     596   755 ..     1   247 []   -70.5      1.3
MCR_beta_N        1/1     616   626 ..   176   186 .]     1.1     0.92
LRR               1/4     656   679 ..     1    25 []     2.2       13
LRR               2/4     680   703 ..     1    25 []    18.4   0.0084
LRR               3/4     704   727 ..     1    25 []     8.1        3
K-box             1/1     722   814 ..     1   105 []   -50.7      2.1
LRR               4/4     728   751 ..     1    25 []    19.3   0.0046

Alignments of top-scoring domains:
HAMP: domain 1 of 1, from 2 to 66: score -8.1, E = 7.5
                   *->lvlvlllalllllllvlllarrllrPlrkLaaaaeriargrggdlte
                      +v+ +l+++l++++++l++ +  +  + +  +++ ++        + 
   At5g66910     2    VVVDWLGLGLGSVAGALVSEGLKV-LISEA-KKVLAF-----KSVSN 41   

                   rlpvggpdEigeLaralNqmrdrLre<-*
                    l+++ +  + ++ + ++ m+d  +    
   At5g66910    42 ELASTME-SLLPVIKEIESMQDGMEL    66   

cellulase: domain 1 of 1, from 24 to 287: score -127.6, E = 6.7
                   *->GnlldatgkpeksyvqlrGvstfwgnpkervahglwfpstkdmidei
                       +l+++  k      +++ vs             l ++ ++ ++  i
   At5g66910    24    KVLISEAKKV----LAFKSVS-----------NELAST-MESLLPVI 54   

                   kaaGfNtvRiPvswealy..kidpalrglnwlnrvdevVdyaidnGmYVI
                   k        i    e++ ++   ++      ++ +d++  +         
   At5g66910    55 K-------EI----ESMQdgMELQD-----LKDTIDKALLLVEKC----- 83   

                   iDwHhdtrwgdpnslwykgdrse........................gat
                      H++  w+ +  + y+  ++e +++  +  + + +    +++ ++ ++
   At5g66910    84 --SHVEK-WNIILKSKYTRKVEEinrkmlkfcqvqlqlllfrnqlksMPS 130  

                   tkekakkfWtqiAtryk..ssnyddvhlifElmNEPrgnggpgewwggtn
                    ++   ++++ i ++  + s+  +++ +                      
   At5g66910   131 MEAILNNYFQNINKKLDrlSGSPAPPLVS--------------------- 159  

                   AtWDtvedwndwkayaqeaid....aIRatgpnndniiivggpgwsqdga
                         ++   +++++   +d +   + +    n  +++v gp   +   
   At5g66910   160 ----KRCSVPKLDNMVLVGLDwplvELKKKLLDN-SVVVVSGPP--GC-- 200  

                   wqtgtvdlansdalasdyYgWWGGNlrvadnPiddkksdnliysvHfYap
                      g+++l+ +              l   d+P   + ++++ ysv     
   At5g66910   201 ---GKTTLVTK--------------L--CDDPEIEGEFKKIFYSV----- 226  

                   yhfsgtwfgddgdattpstwgdegdkssldcvldniarekrlaattwale
                      + +                          +++i ++        + +
   At5g66910   227 VSNTPN--------------------------FRAIVQN-------LLQD 243  

                   nGiPvfiGEfGgsnaskgniggvdvkwadayvdyakerkagggiswvnWd
                   nG        G++  + +  + ++++  +++++++++    g i  v   
   At5g66910   244 NG-------CGAITFD-D--DSQAETGLRDLLEELTKD---GRILLV--- 277  

                   ngpksegtgg<-*
                   + + + g+ +   
   At5g66910   278 LDDVWQGSEF    287  

DUF164: domain 1 of 1, from 26 to 279: score -112.1, E = 3
                   *->mknelksLvkiq....eidkekerLeerikeip..keLkkakellea
                         e+k  ++  + ++e+   +e+L ++ikei++  +   ++ l+  
   At5g66910    26    LISEAKKVLAFKsvsnELASTMESLLPVIKEIEsmQDGMELQDLKDT 72   

                   lkkeveeleqekeelke....evkklekeiqeieek.ikkaEekmdeikt
                   + k+++ l ++   +++ +  +++k +  + ei+ k +k  ++++     
   At5g66910    73 IDKALL-LVEKCSHVEKwniiLKSKYTRKVEEINRKmLKFCQVQLQLLLF 121  

                   qrEYkALerElqkakdkevtlrkeieqlee.....elkkieeeieelkee
                      +k+    + +++     ++k++++l +++ +++  k     ++++  
   At5g66910   122 RNQLKSMPSMEAILNNYFQNINKKLDRLSGspappLVSKRCSVPKLDNMV 171  

                   ilkqEkeleeeeeevelE....vrkikekvlellskreelkektdedlls
                   ++ +   l e+++++  ++   v++    ++  l  ++   ++++ ++ +
   At5g66910   172 LVGLDWPLVELKKKLLDNsvvvVSGPPGCGKTTLVTKLCDDPEIEGEFKK 221  

                   fYERiiknkkn.lviVP..iennvCaGChiiLp....sqfenkVrkePdd
                   ++  +  n  n + iV + + +n C+    +++ +++sq e++ r     
   At5g66910   222 IFYSVVSNTPNfRAIVQnlLQDNGCG----AITfdddSQAETGLRDL--- 264  

                   ivfCPyCSRILYyee<-*
                   ++     +RIL   +   
   At5g66910   265 LEELTKDGRILLVLD    279  

Topoisomerase_I: domain 1 of 1, from 26 to 194: score -152.1, E = 9.3
                   *->adSklKgqsdygKyEkaRRnanRdkIFvkLkdvidkIRkdytkdLdi
                        S  K+  +++   + +          +L++ ++ +   + k++  
   At5g66910    26    LISEAKKVLAFK--SVSN----------ELASTMESLLPVI-KEI-- 57   

                   kksk.......dmkerQvrAvalylIDkfaLRaGneKyedEADTVGcCtL
                    +s +++ + +d+k++      l+ +                        
   At5g66910    58 -ESMqdgmelqDLKDTI-DKALLLVE------------------------ 81   

                   RveHvtlkpDvdlgkpntvtfdFlGKDSiryeneVevdkhrVfknLqkFl
                   ++ Hv+  +         +++      + +y  +Ve+ +     +++kF+
   At5g66910    82 KCSHVEKWN---------IIL------KSKYTRKVEEIN----RKMLKFC 112  

                   dpPKkpgddLFqtvdaGGrdrLd.IlF.tskLNkhLkefMpGLtAKVFRT
                       +    LF       r++L ++   + +LN + +++           
   At5g66910   113 QV--QLQLLLF-------RNQLKsMPSmEAILNNYFQNI----------- 142  

                   YNASiTlqeqLWtNVtkkltkskgnvaekiiplpsikkvynrANrqVAIl
                           + L     ++l    g+ a  +                    
   At5g66910   143 -------NKKL-----DRLS---GSPAPPL-------------------- 157  

                   CNHQrsvSKshYiaqmekldekidalklqiielkkaldeakkkiv<-*
                         vSK+  +++    +++  +l + ++elkk+l++    +v   
   At5g66910   158 ------VSKRC-SVPKL-DNMVLVGLDWPLVELKKKLLDNSVVVV    194  

Fragilysin: domain 1 of 1, from 38 to 354: score -204.1, E = 8.4
                   *->ACsdeldsleesidppveasldLr.SvdYeDLAtvLndvSdfekmIi
                        s+el s  es  p +     +++ ++  DL          +k  +
   At5g66910    38    SVSNELASTMESLLPVIKEIESMQdGMELQDLKDTI------DKALL 78   

                   Lkdng...flrqvsvkadkrvkIeldNenVrLFeGrDKDSisfILgdefA
                   L +  ++ + + +  k     k+e+ N+    F             +   
   At5g66910    79 LVEKCshvEKWNIILKSKYTRKVEEINRKMLKF------------CQVQL 116  

                   vlRlyRnGesIdYIvYKeaerMaEI.AefYaapfkkarainekeiveCiy
                    l l+Rn         K    M  I  +++++  kk              
   At5g66910   117 QLLLFRN-------QLKSMPSMEAIlNNYFQNINKK-------------L 146  

                   derTRSakkDivsvkIdIdKAkGnnkilnLPekDYindklkTPivkhgIl
                   d    S    +vs +  + K   n  + +L   D++   lk     ++++
   At5g66910   147 DRLSGSPAPPLVSKRCSVPKLD-NMVLVGL---DWPLVELKKKLLDNSVV 192  

                   esqtRAvPSePkTvevillrEkdstslenevsaQiQdvanSvkavidlkr
                     +        kT  v  l        + e+      +  Sv       r
   At5g66910   193 VVSGPPG--CGKTTLVTKLCD------DPEIEGEFKKIFYSVVSNTPNFR 234  

                   ivvkyfvlyttekscaSdyaveaLegFtasLksndkveGyDdkiYiLlRd
                    +v     +        d++  a  g    L    k    D +i +L+ d
   At5g66910   235 AIVQNLLQDNGCGAITFDDDSQAETGLRDLLEELTK----DGRI-LLVLD 279  

                   GTWDnGkilGYaSwigs..ynvNntasdFevsaiSTTqlsyPgvlAHElG
                     W     l     i+ ++y +    s F+   +  T    P  l  E  
   At5g66910   280 DVWQGSEFLLRKFQIDLpdYKIL-VTSQFDFTSLWPTYHLVP--LKYEY- 325  

                   HlLGAeHvDnekDLMYtwYtgyltPnHLSedNmvrilknlgk<-*
                              + L+  w ++   P H S d +  +l+ + k   
   At5g66910   326 ----------ARSLLIQWASP---PLHTSPDEYEDLLQKILK    354  

Peptidase_M3: domain 1 of 1, from 39 to 640: score -301.2, E = 7.9
                   *->tlkaLdeledtLcrvydlleflqsahsdkelreaaeeaseklselmn
                      + + L+   + L +v++  e +q+   ++ l ++ ++a  ++++ + 
   At5g66910    39    VSNELASTMESLLPVIKEIESMQDGMELQDLKDTIDKALLLVEKCS- 84   

                   ylslredlytrlkavlddkskaesLdpearrvvekfekdfeksGigLpee
                       ++++ + + ++  +++k+e ++++  +   + ++ ++       + 
   At5g66910    85 ----HVEKWNIILKSK-YTRKVEEINRKMLKFCQVQLQLLLF------RN 123  

                   krekfklikkelselsiaFeknlre.....kkkaahllsftee..eLagl
                   + + +  +   l ++ ++++k+l++ ++++++   +l+s ++  ++L+++
   At5g66910   124 QLKSMPSMEAILNNYFQNINKKLDRlsgspAP---PLVSKRCSvpKLDNM 170  

                   pepvlasaekrtfeelgndeg.yllTlaypty...lplmkyeeneetRek
                       l      +  ++   +++ ++  + p+ ++++ + k ++++e+ e 
   At5g66910   171 VLVGLDWPLV-ELKKKLL-DNsVVVVSGPPGCgktTLVTKLCDDPEI-EG 217  

                   lyrayhnraesndenenrailkellklraelAyLlgrntyAellledkmA
                    ++   +   s     n + ++++++  ++  +  g  t+ +    d +A
   At5g66910   218 EFKKIFYSVVS-----NTPNFRAIVQNLLQ-DNGCGAITFDD----DSQA 257  

                   knpeavlrfldslrekalpnnekelavidelkkkelekrglpgvnelqpW
                   +        l++l e + +++++ l v+d++           +  e++  
   At5g66910   258 E------TGLRDLLEELTKDGRI-LLVLDDVW----------QGSEFL-- 288  

                   DhrYYslrvreekysLdpelelkpYfpltplieGLfelfkelygltfeee
                         lr    k+ +d+ + +k   + +  ++          ++++++ 
   At5g66910   289 ------LR----KFQIDLPD-YKILVTSQFDFT------SLWPTYHLVPL 321  

                   kd................................................
                   k +  ++   +  +++ ++++++ ++  ++  ++ ++ +   +  + + +
   At5g66910   322 KYeyarslliqwaspplhtspdeyedllqkilkrcngfplvievvgislk 371  

                   ......................................akaadgeVwhpD
                   ++     +++ ++ +++++  ++ +++ +++ +++ +  k+  +e   + 
   At5g66910   372 gqalylwkgqveswsegetilgnanptvrqrlqpsfnvLKPHLKECFMDM 421  

                   vrlgevydeilrkgalgefYlDlyaRrGkskrggkrtgacsggqpgsldg
                     ++   +      ++ +++  ly R   s++++k++  + ++      +
   At5g66910   422 GSFLQDQKIR--ASLIIDIWMELYGR--GSSSTNKFML-YLNE---LASQ 463  

                   DgsyqlpvayllcNftkpsagkPsLLtldeVfTLFHEfGHsmHsmlsrth
                                N  k                L+H        + ++++
   At5g66910   464 -------------NLLK----------------LVH--------LGTNKR 476  

                   ysnvsGtrvpiDfvElPSilnEnwlweplvlnllskHyktgep.......
                     +++               nE++++ +++l +l+    ++ep  ++++ 
   At5g66910   477 EDGFY---------------NELLVTQHNILRELAIFQSELEPimqrkkl 511  

                   ........ipdelleklfatkfrqtgf.atfeQiihallDqglHeekkvd
                   + + ++++ pde l+  ++++      ++ f+   ++++  ++   +   
   At5g66910   512 nleirednFPDECLNQPINARLLSIYTdDLFSSKWLEMDCPNVE--A--- 556  

                   lteedltetya..eleekifglsavvkpdkpgtlewarSLyIiFpHlygG
                   l  +  + +ya + + +++++l+  v + ++ ++++ar            
   At5g66910   557 LVLNISSLDYAlpSFIAEMKKLK--VLTIANHGFYPAR------------ 592  

                   GYaAnYYvYlyatvlaadlflakFiedgdlnrenGeryrkefLssGGSkd
                                      f+ +  + + l+r    r+ k       S  
   At5g66910   593 ----------------LSNFS-CLSSLPNLKR---IRFEKV------SVT 616  

                   Plemlkkflgdepskdpfleamgl<-*
                    l++ +  lg + +  +f  ++g+   
   At5g66910   617 LLDIPQLQLGSLKKLSFFMCSFGE    640  

TSC22: domain 1 of 1, from 64 to 120: score -21.2, E = 6.5
                   *->MDLVKsHLmyAVREEVEvLkeqIke...LveklnqLeeENtLLk...
                      M             E   Lk +I     Lvek +  e+ N +Lk++ 
   At5g66910    64    M-------------ELQDLKDTIDKallLVEKCSHVEKWNIILKsky 97   

                   ....tnvSpEqLaqlqaqlqlae<-*
                   +++ + +    L + q qlql     
   At5g66910    98 trkvEEINRKMLKFCQVQLQLLL    120  

NB-ARC: domain 1 of 2, from 159 to 283: score 49.6, E = 8.9e-15
                   *->tslssegevpdesevvGredmieaviekLlemsadenlgvvgivGMG
                      ++++s ++ +d++++vG++ ++ ++++kLl +s      vv ++G++
   At5g66910   159    SKRCS-VPKLDNMVLVGLDWPLVELKKKLLDNS------VVVVSGPP 198  

                   GvGKTTLAkqiyndesevgghFDvvaWvvVSktytekvfrlqkttdilqe
                   G+GKTTL ++   d++ ++g F  +   vVS t +   + +   +++lq+
   At5g66910   199 GCGKTTLVTKLCDDPE-IEGEFKKIFYSVVSNTPNF--RAIV--QNLLQD 243  

                   LgsedgswdddLsqfpsrlvdeknegellavkikelLkrkRfLlVLDDVW
                    g  + + dd          d+  e + l++ + el k +R+LlVLDDVW
   At5g66910   244 NGCGAITFDD----------DSQAETG-LRDLLEELTKDGRILLVLDDVW 282  

                   e<-*
                   +   
   At5g66910   283 Q    283  

HypB_UreG: domain 1 of 1, from 181 to 287: score -69.3, E = 0.32
                   *->pnRarFeahgvlalnlgGsvGSGKTtLLerlieaLkk....delkiA
                      ++++ +  + v++  + G++G GKTtL+++l+++   +++ +++   
   At5g66910   181    ELKKKLLDNSVVV--VSGPPGCGKTTLVTKLCDDPEIegefKKIFYS 225  

                   VItGDiyTkeDAerLrktngvLpeGdriiqVeTGgcCHTAIR.LDAsMvl
                   V+ +   T +  +++++    L +          ++C  AI  +D s  +
   At5g66910   226 VVSN---TPNFRAIVQNL---LQD----------NGCG-AITfDDDSQAE 258  

                   eAieeLpergaaynalddldlLfIENVGNLvCPtffdlGedlkvvviSVt
                    ++ +L e+       +d+ +L+                     v+ +V 
   At5g66910   259 TGLRDLLEEL-----TKDGRILL---------------------VLDDVW 282  

                   EGEDk<-*
                   +G      
   At5g66910   283 QGSEF    287  

SRP54: domain 1 of 1, from 187 to 209: score -1.4, E = 9.1
                   *->kkpnVillVGlqGsGKTTTiAKL<-*
                         +V+++ G+ G GKTT ++KL   
   At5g66910   187    LDNSVVVVSGPPGCGKTTLVTKL    209  

ABC_tran: domain 1 of 1, from 189 to 324: score -75.1, E = 0.9
                   *->GevlalvGpNGaGKSTLLklisGllppteGtilldGardlr.lsklk
                      + v+++ Gp G+GK+TL   ++   +  eG+ +     ++++     
   At5g66910   189    NSVVVVSGPPGCGKTTLVTKLCDDPE-IEGEFKKIF-YSVVsNT--- 230  

                   erlerlrknigvvfQdptlfpnveltvreniafglrlslglskdeqrarl
                                       pn++  v+  +  ++           ++  
   At5g66910   231 --------------------PNFRAIVQNLLQDNGCG-----AITFDDD- 254  

                   kkagaeelLerlglgydhlldrrpgtLSGGqkQRvaiARaLltkpklLlL
                         ++  ++gl   +ll +                  L ++ ++Ll 
   At5g66910   255 -----SQA--ETGLR--DLLEE------------------LTKDGRILL- 276  

                   DEPTagLDpasraqllellrelrqq..ggTvllitHdldlldrla..Dri
                         LD++ ++   e+l +  q +     +l+t + d+   l+++ ++
   At5g66910   277 -----VLDDVWQG--SEFLLRKFQIdlPDYKILVTSQFDF-TSLWptYHL 318  

                   lvledG<-*
                   + l+     
   At5g66910   319 VPLKYE    324  

SKI: domain 1 of 1, from 189 to 334: score -92.5, E = 4
                   *->rnifLI.GmmGaGKsTvGrlLAkaLgreFvDlDqlIEertGnmtIae
                       +++ ++G++G+GK+T+          ++ D D +IE +++ +    
   At5g66910   189    NSVVVVsGPPGCGKTTL--------VTKLCD-DPEIEGEFK-KIFYS 225  

                   IFeeeGEdgFRkrEtevlkelltekkegyViSTGGGiVe.......seen
                   ++     ++FR+    +++ ll++         G G+++ +++++    +
   At5g66910   226 VVSNT--PNFRA----IVQNLLQDN--------GCGAITfdddsqaETGL 261  

                   RnlLtdYaeanGiVvyLdadieelikRlqtdkeeRPlLqeesmvYDeeee
                   R+lL       G+ ++   d+     +l ++ +      + +       +
   At5g66910   262 RDLLEE-LTKDGRILLVLDDVWQGSEFLLRKFQ-----IDLPD-----YK 300  

                   reklayeRcplYqevadrtidtndqppielnlaeiaseilqtit<-*
                    ++     + ++    +   ++ ++        e a+ +l++++   
   At5g66910   301 ILVTS---QFDFTSLWPTYHLVPLKY-------EYARSLLIQWA    334  

AAA: domain 1 of 1, from 191 to 501: score -51.0, E = 0.97
                   *->gvLLyGPPGtGKTlLAkavAkelg......vpfisisg.........
                       v  +GPPG+GKT+L+  ++     +++ +  f s+ +++++ +   
   At5g66910   191    VVVVSGPPGCGKTTLVTKLCDDPEiegefkKIFYSVVSntpnfraiv 237  

                   .............selvskyvGesekrvralfelArkslkkaaPspiiFI
                   ++  ++++ +  + ++      + e+ +r+l+e+  k+    +    + +
   At5g66910   238 qnllqdngcgaitFDDD----SQAETGLRDLLEELTKD----GRI-LLVL 278  

                   DEi....DalapkRgd..egdvservvnqLLtemDL.e............
                   D++ +++  l +k +  +  d    v +q++ +  L  + +  + + +  
   At5g66910   279 DDVwqgsEFLLRK-FQidLPDYKILVTSQFDFTS-LwPtyhlvplkyeya 326  

                   ..................................................
                   ++   +  +++ ++++++ ++  ++  ++ ++ +   +  + + +++   
   At5g66910   327 rslliqwaspplhtspdeyedllqkilkrcngfplvievvgislkgqaly 376  

                   ..............................rigfekhylrvsdvvDlsgv
                     +++ ++ +++++  ++ +++ +++ +++++ +++h         l++ 
   At5g66910   377 lwkgqveswsegetilgnanptvrqrlqpsFNVLKPH---------LKEC 417  

                   iviaaTNrpdlldpaLlrpGRfdrrievplP....deeerleIlkihlkk
                   ++ + +     l +  +r   +++ i   l++++++   ++      l++
   At5g66910   418 FMDMGS----FLQDQKIRAS-LIIDIWMELYgrgsSSTNKFMLYLNELAS 462  

                   mplalcqerselakdvdldelakelArrtpgfsgadlaa...lcreAalr
                    +l          k v+l        +r +gf +  l+ +++++re a++
   At5g66910   463 QNLL---------KLVHLGT-----NKREDGFYNELLVTqhnILRELAIF 498  

                   alr<-*
                     +   
   At5g66910   499 QSE    501  

PRK: domain 1 of 1, from 191 to 209: score 5.4, E = 0.08
                   *->vIGvaGsSGaGKTtvarri<-*
                      v +v G+ G+GKTt   ++   
   At5g66910   191    VVVVSGPPGCGKTTLVTKL    209  

Viral_helicase1: domain 1 of 1, from 192 to 212: score 15.4, E = 5.7e-05
                   *->ivVhGVpGcGKStlIrkllrt<-*
                      +vV+G pGcGK+tl+ kl ++   
   At5g66910   192    VVVSGPPGCGKTTLVTKLCDD    212  

adenylatekinase: domain 1 of 1, from 194 to 202: score 5.4, E = 0.12
                   *->LlGpPGaGK<-*
                      + GpPG+GK   
   At5g66910   194    VSGPPGCGK    202  

rrm: domain 1 of 1, from 204 to 277: score -19.4, E = 6.7
                   *->lfVgNL.ppdvteedLkdlFsk.fGpivsikivrDiiekpketgksk
                        V+ L      e + k++F        +++ +       ++  + +
   At5g66910   204    TLVTKLcDDPEIEGEFKKIFYSvVSNTPNFRAIV------QNLLQDN 244  

                   GfaFVeFeseedAekAlealnG.kelggrklrv<-*
                   G++ ++F++ ++Ae  l++l ++ + +gr l v   
   At5g66910   245 GCGAITFDDDSQAETGLRDLLEeLTKDGRILLV    277  

PFK: domain 1 of 1, from 263 to 274: score -2.7, E = 6.2
                   *->sLleeLvkeGki<-*
                      +LleeL k+G+i   
   At5g66910   263    DLLEELTKDGRI    274  

CK_II_beta: domain 1 of 1, from 279 to 407: score -153.2, E = 6.5
                   *->dedSGAYDEWIdwFlGlkGNEFF...CeVD.edY...IqDrFNLtGL
                      d++               G EF+ ++ + D +dY+  ++  F  t+L
   At5g66910   279    DDVW-------------QGSEFLlrkFQIDlPDYkilVTSQFDFTSL 312  

                   ...seeVP.hYsqaLDlILDleddsdlEedteDVVEEDEVDqEmqSNDGH
                    ++ ++VP +Y++a  l     ++     +                    
   At5g66910   313 wptYHLVPlKYEYARSLLIQWASPP----LHT------------------ 340  

                   DEGKRRNKSPVensdliEsaAekLYGLIHARYILTerGLqaMleKYkegD
                           SP e  dl                      Lq+ l       
   At5g66910   341 --------SPDEYEDL----------------------LQKILKR----- 355  

                   FGrCPRVYCngQplLPVGLSDipGkstVKLYCPrCeDvYtPkSsRhtsiD
                           Cng pl       ++G+s       + + +Y+ k +  +  +
   At5g66910   356 --------CNGFPL----VIEVVGISL------KGQALYLWKGQVESWSE 387  

                   GAYFGTSFPhmFlqvfPeLepYVEkkpterY<-*
                   G              +++  p V  + ++++   
   At5g66910   388 GE-----------TILGNANPTVRQRLQPSF    407  

ACOX: domain 1 of 1, from 332 to 356: score -2.0, E = 6.2
                   *->ewvkqqsplnetrevkPsYekyLkpmlnra<-*
                      +w++   p+  t   +++Ye+ L+  l+r    
   At5g66910   332    QWAS---PPLHTS--PDEYEDLLQKILKRC    356  

NB-ARC: domain 2 of 2, from 341 to 440: score 33.1, E = 5.2e-10
                   *->ehpelEevakeivekCkGLPLalkvlGglLasKktveeeWkhvleql
                      ++ e+E+++ +i ++C G PL++ v+G +L+  + +   Wk   e++
   At5g66910   341    SPDEYEDLLQKILKRCNGFPLVIEVVGISLKG-QAL-YLWKGQVESW 385  

                   nnelagRrksssselnevlsiLklSYdnLpsdhLKrCFlylaDEDRSALA
                   +  +      +      v+ +L+ S++ L++ hLK+CF + +        
   At5g66910   386 SEGETI----LGNANPTVRQRLQPSFNVLKP-HLKECFMDMG-------- 422  

                   FAVlfPedydipkkqlislWi<-*
                       f++d++i+++  i+ W+   
   At5g66910   423 ---SFLQDQKIRASLIIDIWM    440  

RNA_dep_RNApol2: domain 1 of 1, from 365 to 719: score -258.9, E = 5.7
                   *->tsDisldclddcrldpsklkpfpkkkekylvPvlrtaapspRqnTlk
                       + isl   + + l  + + ++ ++        l +a p  Rq    
   At5g66910   365    VVGISLK-GQALYLWKGQVESWSEGET-----ILGNANPTVRQ---- 401  

                   EvLlAlkKRNmNvPeLqesvdldetae.rvverFk..ksfldeekldefk
                                 +Lq s++   + ++ + e+F++  sfl++ k++   
   At5g66910   402 --------------RLQPSFN---VLKpHLKECFMdmGSFLQDQKIR--- 431  

                   ldpiisttesvsrwldkqsgkkaaqlFAkredvvpLheWvdldrYkhMiK
                    ++ i++   +  + +  s++++  +   + +++ L+  ++l +++h   
   At5g66910   432 -ASLIID-IWMELYGRGSSSTNK--F--ML-YLNELAS-QNLLKLVHL-- 471  

                   sDvKPklDlslqsTEEypalQTIvYHdKlv...talFsPiFkelveRlly
                   +  K    ++++   E  + Q      + + ++ a+F      ++ R ++
   At5g66910   472 GTNK--REDGFYN--ELLVTQ------HNIlreLAIFQSELEPIMQRKKL 511  

                   vLkp.kvvfptgmsaedtssllaenfedldaeeayef....lEiDfSKFD
                    L  +   fp +      ++ +++++  + +  +  f+++ lE D     
   At5g66910   512 NLEIrEDNFPDEC----LNQPINARLLSIYT--DDLFsskwLEMDC---- 551  

                   KSQgelHllvqleIlklLGldeeladlWfkfheqsyiHLPTkdfkaGvgf
                            v+ ++l+   ld  l          ++      ++k+ v +
   At5g66910   552 -------PNVEALVLNISSLDYALPS--------FIA----EMKKLKVLT 582  

                   svdyQRkSGdanTylgNT......lvtaamlasvldledPkidcaaFsGD
                                 ++N++  + +l++ ++l+s   l   +i++  +s  
   At5g66910   583 --------------IANHgfyparLSNFSCLSSLPNLK--RIRFEKVS-- 614  

                   DSLIfspkplledpasrfatlfNfEaKlfdpkvPYFCSKFLlevdggaGG
                          + ll +p+  + +         ++   ++CS   +  d+ +  
   At5g66910   615 -------VTLLDIPQLQLGS--------LKKLSFFMCSFGEVFYDTED-- 647  

                   kvffVPDPlKllqKLGkkkipddqDeelLdEiftSlcDltksfndecvvl
                     + V  +l  lq   +  + d              +D++ ++  e+v l
   At5g66910   648 --IDVSKALSNLQEIDIDYCYD--------------LDELPYWIPEVVSL 681  

                   elldlavaryykyagegyaalcallkal.ssfklffsl<-*
                   ++l     + + + +e+++ l  l++ + +s++++++l   
   At5g66910   682 KTLSITNCNKLSQLPEAIGNLSRLEVLRmCSCMNLSEL    719  

IFN-gamma: domain 1 of 1, from 391 to 511: score -52.2, E = 9.9
                   *->iLgssGcYCqdtfikeienLkeYFnasssDVadggsLFldIlrnWke
                      iLg      +  +  +   Lk  ++   +D       Fl        
   At5g66910   391    ILGNANPTVRQRLQPSFNVLKPHLKECFMDMGS----FLQ------- 426  

                   esDkkIiqSQIvSFYfkLFenLKDn.qaIqksmdvIkedlfvkFfnsska
                     D+kI  S I+  ++ L+      +      ++   +  + k+    ++
   At5g66910   427 --DQKIRASLIIDIWMELYGRGSSStNKFMLYLNELASQNLLKLVHLGTN 474  

                   Kkdd.FekLikisVndlqv.QRkAinELikVmndLsPksnLrKR<-*
                   K++d+F        n+l v+Q+  + EL     +L P  + +K    
   At5g66910   475 KREDgFY-------NELLVtQHNILRELAIFQSELEPIMQRKKL    511  

FH2: domain 1 of 1, from 404 to 799: score -203.3, E = 9.7
                   *->pkkvpkpkkpLKqLhWdkletlkqpdapPsekskgtvWgttlndeld
                      +++ +  k  LK       e+        + +++ ++      ++++
   At5g66910   404    QPSFNVLKPHLK-------EC--------FMDMG-SFL-----QDQK 429  

                   etklLenegdldeleelFatkektksakkgdvsetksklmkkkvkknlki
                         +++++d   el+           g+ s ++        +k + +
   At5g66910   430 IR----ASLIIDIWMELY-----------GRGSSST--------NK-FML 455  

                   ldpkrsqnppleIllrslhcdmsieetvikvailevDevkvlsedlleqL
                    + ++++      +l +l +++  +    ++  +++    v + + l+  
   At5g66910   456 YLNELASQ-----NLLKL-VHLGTNK---REDGFYNEL-LVTQHNILRE- 494  

                   lkfaPYsktkeelkklrevkedkekdleeLsraeqiFllllsnLipylee
                      +++   ++el+++++ k+      +   r++  F  +++n  + +++
   At5g66910   495 ---LAI--FQSELEPIMQRKKL-----NLEIREDN-FPDECLN--QPINA 531  

                   Rlkallfklnfe........eevedLkpklekvtaAsee.LreSkkFkkl
                   Rl ++     f+++  + + ++ve L+ ++ +++ A  + + e+kk+k  
   At5g66910   532 RLLSIYTDDLFSskwlemdcPNVEALVLNISSLDYALPSfIAEMKKLK-- 579  

                   LeliLaiGNyMNggsrrrgqAkGFk.LssLtkLsdvKsadnktTLLHylv
                      +L i N+ + ++ r    + F+ LssL  L+ ++  +  +TLL+   
   At5g66910   580 ---VLTIANHGF-YPAR---LSNFScLSSLPNLKRIRFEKVSVTLLD--- 619  

                   kiirekypelldFysdlhhvdeaSsrkvnleelekdvkslekqiknlEts
                    i   + + l ++  ++ + +e+    ++ e+      ++ k+  nl+  
   At5g66910   620 -IPQLQLGSLKKLSFFMCSFGEV---FYDTED-----IDVSKALSNLQ-E 659  

                   ldlgnlsdpelhpdDkflevmrpFlkaAkekfdkLqkdlkdmktrleslv
                   +d+  + d + +p    + +          ++  L++   +  ++l  l 
   At5g66910   660 IDIDYCYDLDELP----YWI---------PEVVSLKTLSITNCNKLSQLP 696  

                   eyygedpkddlspneFFkdfneFleefkkarkenlAEeqrkekeeelkrr
                   e +g      ls+ e++ +          +   nl  +++ e+ e+l ++
   At5g66910   697 EAIGN-----LSRLEVLRM----------CSCMNL--SELPEATERLSNL 729  

                   rklalka...lskeklereqgkskqkentlerrkernplmdgeaekeqdf
                   r l   +++ l  +kl +e gk  + en + r+  ++  +   +  ++  
   At5g66910   730 RSLD--IshcLGLRKLPQEIGKLQKLENISMRK--CSGCELPDS--VRYL 773  

                   kgvlds.......llkalrtdssfrr<-*
                   +++  + ++ ++ l+++l+  ++++r   
   At5g66910   774 ENLEVKcdevtglLWERLMPEMRNLR    799  

MatK_N: domain 1 of 1, from 442 to 693: score -134.0, E = 5.7
                   *->myqqm.yQqNhlinisvNDsnqNkFlgy........NknlYsqqmIs
                      +y   +   N ++ ++ N +    +l+  + +++++   +Y  +++ 
   At5g66910   442    LYGRGsSSTNKFM-LYLNELASQNLLKLvhlgtnkrEDGFYN-ELLV 486  

                   EGFAviVEIpFslRLls.slegkeivkshnlrsihsifpfledkfshlny
                       +  E   +   l ++ ++k      nl     +fp    +      
   At5g66910   487 TQHNILRELAIFQSELEpIMQRK----KLNLEIREDNFPDECLNQPINAR 532  

                   vldil...ipypihleilvqtLrYwVKdASSLHLLRFFLheYpnWnssli
                   +l i +++   +  le+   +    V   SSL         Y  + s +i
   At5g66910   533 LLSIYtddLFSSKWLEMDCPNVEALVLNISSL--------DYA-LPS-FI 572  

                   tskpkksfsfssKrNqRlF.lfLYNsyVcEYESifvflrNQsSHLrStSs
                   ++  kk  + ++  N+ + +  L N+                S+L S + 
   At5g66910   573 AEM-KK-LKVLTIANHGFYpARLSNF----------------SCLSSLPN 604  

                   gtlLERIyFYgKieh.lvev..FakdFkaiLWLFKDPFlHyvRyqgksil
                      L RI F +K+  +l+ +++      + L +F+  F   + y  + i 
   At5g66910   605 ---LKRIRF-EKVSVtLLDIpqLQLGSLKKLSFFMCSFGEVF-YDTEDID 649  

                   askgtsllmnkwKyYLVnFWqcyFylWsqprrIhInQLsnhSLdFLG<-*
                   +sk  s l +  + Y   + +  + +   p+ +  + Ls  + + L    
   At5g66910   650 VSKALSNLQEIDIDYCYDLDELPYWI---PEVVSLKTLSITNCNKLS    693  

DUF41: domain 1 of 1, from 596 to 755: score -70.5, E = 1.3
                   *->lteeQLlstFsNvkhli.GslevqnTnf...kslsFLanLesIecgi
                      ++    ls++ N k+++   ++v+  ++++ + +s L++L  + c+ 
   At5g66910   596    FSC---LSSLPNLKRIRfEKVSVTLLDIpqlQLGS-LKKLSFFMCS- 637  

                   rkrnkdrvrkildnihdnpfswidnqnmlelgllnlTnmtrlgLpilsnl
                       ++ v+ ++ +i+++                                
   At5g66910   638 ----FGEVFYDTEDIDVSK------------------------------- 652  

                   dlnkLnlpnlknisnpnstgekiivnfenlhpdFClTteEllnfflnsnv
                            l+n+++ +               d C  + El +++  + v
   At5g66910   653 --------ALSNLQEID--------------IDYCYDLDELPYWI-PEVV 679  

                   sienleakyCepksrifflikktdngivyklCnfkslsssvnLdngCtiI
                   s ++l  ++C+  s         ++     + n ++l+     + +C   
   At5g66910   680 SLKTLSITNCNKLS-------QLPEA----IGNLSRLE----VLRMCSCM 714  

                   fGdLvIgpgdEeyVskLknveviFGsLiIqNTnLtnidFLenLkyIasLe
                   + +   +++    +s+L ++ +         +   ++   +  + I  L+
   At5g66910   715 NLSELPEATER--LSNLRSLDI---------SHCLGLR--KLPQEIGKLQ 751  

                   dsvs<-*
                   +  +   
   At5g66910   752 KLEN    755  

MCR_beta_N: domain 1 of 1, from 616 to 626: score 1.1, E = 0.92
                   *->tlLgiPqklEG<-*
                      tlL+iPq++ G   
   At5g66910   616    TLLDIPQLQLG    626  

LRR: domain 1 of 4, from 656 to 679: score 2.2, E = 13
                   *->nLeeLdLsnN.nLsGslPpesfgnLp<-*
                      nL+e+d++++  L  +lP  ++       
   At5g66910   656    NLQEIDIDYCyDLD-ELPY-WIPEVV    679  

LRR: domain 2 of 4, from 680 to 703: score 18.4, E = 0.0084
                   *->nLeeLdLsnN.nLsGslPpesfgnLp<-*
                      +L++L++ n+++Ls +lP+ ++gnL+   
   At5g66910   680    SLKTLSITNCnKLS-QLPE-AIGNLS    703  

LRR: domain 3 of 4, from 704 to 727: score 8.1, E = 3
                   *->nLeeLdLsnN.nLsGslPpesfgnLp<-*
                      +Le+L + ++ nLs +lP+ + + L+   
   At5g66910   704    RLEVLRMCSCmNLS-ELPE-ATERLS    727  

K-box: domain 1 of 1, from 722 to 814: score -50.7, E = 2.1
                   *->dsyqkssgnsslwesnyqnwqqEaaKLkaqienLQ..nNrnqRhllG
                      + +  +s+ +sl+ s     +  ++KL ++i +LQ+  N++ R+  G
   At5g66910   722    ATER-LSNLRSLDIS----HCLGLRKLPQEIGKLQklENISMRKCSG 763  

                   EdLgsLslKELqqLEqqLEkgLkhIRsrKnqllldqieelqkKErelqee
                    +L + s++ L++LE + ++  +   +r +  +++ + ++   E++l+ +
   At5g66910   764 CELPD-SVRYLENLEVKCDEVTGLLWERLMPEMRNLRVHTEETEHNLKLL 812  

                   NkaLrkKiee<-*
                    +           
   At5g66910   813 LT--------    814  

LRR: domain 4 of 4, from 728 to 751: score 19.3, E = 0.0046
                   *->nLeeLdLsnN.nLsGslPpesfgnLp<-*
                      nL++Ld+s++  L+ +lP+e +g+L+   
   At5g66910   728    NLRSLDISHClGLR-KLPQE-IGKLQ    751  

//